Protein detail
RALA
Ras-related protein Ral-A (EC 3.6.5.2)
Entry name RALA | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Disease related genesEnzymesHuman disease related genesPotential drug targetsPredicted intracellular proteinsRAS pathway related proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Ras-related protein Ral-A (EC 3.6.5.2)
Protein Class (6)
Disease related genesEnzymesHuman disease related genesPotential drug targetsPredicted intracellular proteinsRAS pathway related proteins
Protein Function (7)
- Predicted intracellular proteins
- Potential drug targets
- RAS pathway related proteins
- Human disease related genes:Congenital malformations:Congenital malformations of the nervous system
- Enzymes
- ENZYME proteins:Hydrolases
- Disease related genes
Ensembl
Entrez Gene Symbol
Gene Synonym
RAL
Gene Description
RAS like proto-oncogene A
Chromosome
7
Position
39623565-39708120
Supporting publications (n)
1
EVMP confidence score
0.40
Fluorescence & Localization
Cell SpecificAlveolar cells type 1
Function & Pathway
Protein Function (7)
- Predicted intracellular proteins
- Potential drug targets
- RAS pathway related proteins
- Human disease related genes:Congenital malformations:Congenital malformations of the nervous system
- Enzymes
- ENZYME proteins:Hydrolases
- Disease related genes
Cellular Component (11)
- GO:0005739 mitochondrion
- GO:0005886 plasma membrane
- GO:0005925 focal adhesion
- GO:0009986 cell surface
- GO:0030139 endocytic vesicle
- GO:0030659 cytoplasmic vesicle membrane
- GO:0032154 cleavage furrow
- GO:0070062 extracellular exosome
- GO:0090543 Flemming body
- GO:0097060 synaptic membrane
Page 1 of 2
Molecular Function (9)
Biological Process (3)
KEGG (7)
Reactome (13)
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-8950505 gene and protein expression by jak stat signaling after interleukin 12 stimulation
- R-hsa-447115 interleukin 12 family signaling
- R-hsa-9020591 interleukin 12 signaling
- R-hsa-199991 membrane trafficking
- R-hsa-171007 p38mapk events
- R-hsa-449147 signaling by interleukins
- R-hsa-166520 signaling by ntrks
- R-hsa-9006934 signaling by receptor tyrosine kinases
- R-hsa-187687 signalling to erks
Page 1 of 2
Mediation Categories (4)
Adhesion and uptake mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence23
Enzyme-Mediated Modification (7)
7 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| RALA | PPP2CB | P62714 | S | 183 | dephosphorylation | SIGNOR | SIGNOR:17540176 |
| RALA | PPP2CB | P62714 | S | 194 | dephosphorylation | SIGNOR | SIGNOR:17540176 |
| RALA | PPP2CB | P62714 | S | 194 | phosphorylation | SIGNOR_ProtMapperProtMapper | ProtMapper:17540176 |
| RALA | PPP2CB | P62714 | S | 183 | phosphorylation | SIGNOR_ProtMapperProtMapper | ProtMapper:17540176 |
| RALA | PPP2R1B | P30154 | S | 183 | dephosphorylation | HPRD | HPRD:17540176 |
| RALA | PPP2R1B | P30154 | S | 194 | dephosphorylation | HPRD | HPRD:17540176 |
| RALA | AURKA | O14965 | S | 194 | phosphorylation | Sparser_ProtMapperPhosphoSite_MIMPMIMPProtMapperRLIMS-P_ProtMapperKEAREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:23830877ProtMapper:29047224ProtMapper:20940393ProtMapper:24222664ProtMapper:25987188KEA:15637052ProtMapper:21170262ProtMapper:30070631ProtMapper:19901077ProtMapper:21822277 |
Ligand-Receptor Signaling (9)
9 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | GO_Intercell | Yes | ||||
| receptor | receptor | OmniPath | Yes | ||||
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath |
Regulatory Interaction Network (5)
5 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| RALA | P11233 | FOXO4 | P98177 | Yes | Yes | SIGNOR_ProtMapperREACH_ProtMapperSIGNORProtMapper | SIGNOR:11689711ProtMapper:11689711ProtMapper:33396222 | |
| PP2AB | P62714 | RALA | P11233 | Yes | Yes | SIGNOR_ProtMapperSIGNORProtMapper | SIGNOR:17540176ProtMapper:17540176 | |
| COMPLEX:Q6GYQ0_Q86X10 | RALA | P11233 | Yes | Yes | SIGNOR | SIGNOR:21148297 | ||
| AURKA | O14965 | RALA | P11233 | Yes | Yes | Sparser_ProtMapperPhosphoSite_MIMPMIMPiPTMnetPhosphoPointSIGNORProtMapperRLIMS-P_ProtMapperPhosphoSite_KEAKEAREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:30995277ProtMapper:23830877ProtMapper:20696399ProtMapper:20940393ProtMapper:29047224ProtMapper:24222664PhosphoSite:34480001PhosphoSite:19901077ProtMapper:34359657ProtMapper:25987188KEA:15637052ProtMapper:30995277SIGNOR:21822277ProtMapper:21170262ProtMapper:30070631PhosphoSite:17540176ProtMapper:19901077ProtMapper:21822277 | |
| COMPLEX:Q2PPJ7_Q86X10 | RALA | P11233 | Yes | Yes | SIGNOR | SIGNOR:21148297 |
Protein Complex Composition (1)
Sequence, Structure & Domains
Sequences
Length
206
Mass
23,567
Sequence
MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL
3D Structural Models
Turn
158..160; 196..200
Helix
27..36; 76..85; 98..115; 132..134; 139..149; 164..178
Beta Strand
13..20; 49..57; 60..68; 87..94; 120..127; 152..156; 189..191
3D Structure
NMR spectroscopy (1); X-ray crystallography (15)
Domain & Motif Annotations
Motif
43..51; Effector region
Protein Families (2)
- Small GTPase superfamily
- Ras family
Sequence Similarities
Belongs to the small GTPase superfamily. Ras family.
Clinical Relevance
Disease Involvement (2)
Disease variantIntellectual disability
Related Diseases
Drugs
Interaction Protein (4)
ENSG00000017797ENSG00000137713ENSG00000174775ENSG00000198668
Interaction Count
4
Interaction Dataset (2)
intact_biogridbiogrid_opencell
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 40748658 | Exosomes released from senescent cells and circulatory exosomes isolated from human plasma reveal aging-associated proteomic and lipid signatures. | No related sentences available |