Protein detail
FGFR1
Fibroblast growth factor receptor 1 (FGFR-1) (EC 2.7.10.1) (Basic fibroblast growth factor receptor 1) (BFGFR) (bFGF-R-1) (Fms-like tyrosine kinase 2) (FLT-2) (N-sam) (Proto-oncogene c-Fgr) (CD antigen CD331)
Protein symbol FGFR1 | UniProt ID | EVMP score 0.25 |
Frequency 1 | Transmembrane count 1 | Protein classification Cancer-related genesCD markersDisease related genesEnzymesFDA approved drug targetsHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsRAS pathway related proteinsTransporters |
Basic Information
Protein Names
Fibroblast growth factor receptor 1 (FGFR-1) (EC 2.7.10.1) (Basic fibroblast growth factor receptor 1) (BFGFR) (bFGF-R-1) (Fms-like tyrosine kinase 2) (FLT-2) (N-sam) (Proto-oncogene c-Fgr) (CD antigen CD331)
Protein Class
Cancer-related genesCD markersDisease related genesEnzymesFDA approved drug targetsHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsRAS pathway related proteinsTransporters
Protein Function
- Predicted intracellular proteins
- Human disease related genes:Congenital malformations:Congenital malformations of the musculoskeletal system
- ENZYME proteins:Transferases
- Human disease related genes:Cancers:Cancers of the breast and female genital organs
- Human disease related genes:Endocrine and metabolic diseases:Hypothalamus and pituitary gland diseases
- CD markers
- RAS pathway related proteins
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
- Transporters:Accessory Factors Involved in Transport
- Human disease related genes:Congenital malformations:Other congenital malformations
- Kinases:Tyr protein kinases
- Disease related genes
- FDA approved drug targets:Small molecule drugs
Transmembrane
377..397; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
BFGFRCD331CEKFLGFLT2H2H3H4H5KAL2N-SAM
Gene Description
Fibroblast growth factor receptor 1
Chromosome
8
Position
38400215-38468834
Frequency
1
EVMP Score
0.25
Fluorescence & Localization
Function & Pathway
Protein Function
- Predicted intracellular proteins
- Human disease related genes:Congenital malformations:Congenital malformations of the musculoskeletal system
- ENZYME proteins:Transferases
- Human disease related genes:Cancers:Cancers of the breast and female genital organs
- Human disease related genes:Endocrine and metabolic diseases:Hypothalamus and pituitary gland diseases
- CD markers
- RAS pathway related proteins
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
- Transporters:Accessory Factors Involved in Transport
- Human disease related genes:Congenital malformations:Other congenital malformations
- Kinases:Tyr protein kinases
- Disease related genes
- FDA approved drug targets:Small molecule drugs
Cellular Component
Molecular Function
- GO:0004713 protein tyrosine kinase activity
- GO:0005007 fibroblast growth factor receptor activity
- GO:0005515 protein binding
- GO:0005524 ATP binding
- GO:0008201 heparin binding
- GO:0017134 fibroblast growth factor binding
- GO:0042169 SH2 domain binding
- GO:0042802 identical protein binding
- GO:0042803 protein homodimerization activity
- GO:0090722 receptor-receptor interaction
KEGG
- hsa04010 MAPK signaling pathway
- KEGG:hsa04014 Ras signaling pathway
- KEGG:hsa04015 Rap1 signaling pathway
- KEGG:hsa04020 Calcium signaling pathway
- KEGG:hsa04151 PI3K-Akt signaling pathway
- KEGG:hsa04517 IgSF CAM signaling
- KEGG:hsa04519 Cadherin signaling
- KEGG:hsa04520 Adherens junction
- KEGG:hsa04550 Signaling pathways regulating pluripotency of stem cells
- KEGG:hsa04714 Thermogenesis
- KEGG:hsa04810 Regulation of actin cytoskeleton
- KEGG:hsa04928 Parathyroid hormone synthesis, secretion and action
- KEGG:hsa05200 Pathways in cancer
- KEGG:hsa05205 Proteoglycans in cancer
- KEGG:hsa05215 Prostate cancer
- KEGG:hsa05218 Melanoma
- KEGG:hsa05224 Breast cancer
- KEGG:hsa05230 Central carbon metabolism in cancer
Reactome
- R-hsa-2219530 constitutive signaling by aberrant pi3k in cancer
- R-hsa-5663202 diseases of signal transduction by growth factor receptors and second messengers
- R-hsa-5654687 downstream signaling of activated fgfr1
- R-hsa-9758919 epithelial mesenchymal transition emt during gastrulation
- R-hsa-190370 fgfr1b ligand binding and activation
- R-hsa-190373 fgfr1c ligand binding and activation
- R-hsa-190242 fgfr1 ligand binding and activation
- R-hsa-1839124 fgfr1 mutant receptor activation
- R-hsa-9793380 formation of paraxial mesoderm
- R-hsa-5654693 frs mediated fgfr1 signaling
- R-hsa-9758941 gastrulation
- R-hsa-74751 insulin receptor signalling cascade
- R-hsa-9006925 intracellular signaling by second messengers
- R-hsa-112399 irs mediated signalling
- R-hsa-373760 l1cam interactions
- R-hsa-5684996 mapk1 mapk3 signaling
- R-hsa-5683057 mapk family signaling cascades
- R-hsa-375165 ncam signaling for neurite out growth
- R-hsa-5654726 negative regulation of fgfr1 signaling
- R-hsa-199418 negative regulation of the pi3k akt network
- R-hsa-9675108 nervous system development
- R-hsa-5654219 phospholipase c mediated cascade fgfr1
- R-hsa-2219528 pi3k akt signaling in cancer
- R-hsa-5654689 pi 3k cascade fgfr1
- R-hsa-5654688 shc mediated cascade fgfr1
- R-hsa-1839122 signaling by activated point mutants of fgfr1
- R-hsa-190236 signaling by fgfr
- R-hsa-5654736 signaling by fgfr1
- R-hsa-5655302 signaling by fgfr1 in disease
- R-hsa-1226099 signaling by fgfr in disease
- R-hsa-74752 signaling by insulin receptor
- R-hsa-9006934 signaling by receptor tyrosine kinases
- R-hsa-2404192 signaling by type 1 insulin like growth factor 1 receptor igf1r
- R-hsa-445144 signal transduction by l1
Mediation Categories
Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
23 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| FGFR1 | PRKCE | Q02156 | S | 779 | phosphorylation | SIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:23564461ProtMapper:23564461 |
| FGFR1 | PRKCE | Q02156 | S | 810 | phosphorylation | MIMPPhosphoSite_MIMP | |
| FGFR1 | MAPK14 | Q16539 | S | 777 | phosphorylation | Sparser_ProtMapperSIGNORProtMapperRLIMS-P_ProtMapperKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | KEA:18411303ProtMapper:20626350ProtMapper:18411303SIGNOR:20626350 |
| FGFR1 | MAPK14 | Q16539 | S | 808 | phosphorylation | MIMPPhosphoSite_MIMP | |
| FGFR1 | MAPK3 | P27361 | S | 777 | phosphorylation | Sparser_ProtMapperSIGNORProtMapperSIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:27342992ProtMapper:23405013SIGNOR:23405013 |
| FGFR1 | MAPK3 | P27361 | S | 808 | phosphorylation | MIMPPhosphoSite_MIMP | |
| FGFR1 | MAPK1 | P28482 | S | 777 | phosphorylation | Sparser_ProtMapperSIGNORProtMapperRLIMS-P_ProtMapperSIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:27342992ProtMapper:23405013SIGNOR:23405013 |
| FGFR1 | MAPK1 | P28482 | S | 808 | phosphorylation | MIMPPhosphoSite_MIMP | |
| FGFR1 | MMP2 | P08253 | V | 366 | cleavage | HPRD | HPRD:8692946 |
| FGFR1 | MMP2 | P08253 | V | 279 | cleavage | HPRD | HPRD:8692946 |
Page 1 of 3Next
Ligand-Receptor Signaling
68 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| kinase | receptor | Almen2009 | No | Yes | No | Yes | No |
| growth_factor | receptor | Baccin2019 | No | Yes | No | Yes | No |
| cytokine | receptor | Baccin2019 | No | Yes | No | Yes | No |
| receptor_tyrosine_kinases_rtk | receptor | HPMR | No | Yes | No | Yes | No |
| fgr | receptor | HPMR | No | Yes | No | Yes | No |
| kinase | receptor | Surfaceome | No | Yes | No | Yes | No |
| fgfr | receptor | Surfaceome | No | Yes | No | Yes | No |
| growth_factor | receptor | ICELLNET | No | Yes | No | Yes | No |
| growth_factor_fgf_family | receptor | ICELLNET | No | Yes | No | Yes | No |
| receptor | receptor | OmniPath | No | Yes | No | Yes | No |
Regulatory Interaction Network
23 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| FGFR1 | P11362 | AMOL2 | Q9Y2J4 | Yes | Yes | No | iPTMnetSIGNORProtMapperPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:21937427SIGNOR:21937427 |
| FGFR1 | P11362 | ITB4 | P16144 | Yes | No | No | Sparser_ProtMapperiPTMnetProtMapperPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:23677256PhosphoSite:11438664ProtMapper:26918348 |
| FGFR1 | P11362 | IDHC | O75874 | Yes | No | No | Sparser_ProtMapperPhosphoSitePhosphoSite_ProtMapperProtMapper | ProtMapper:30862724PhosphoSite:30862724 |
Page 3 of 3Previous
Protein Complex Composition
12 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| FGF21-FGFR1c-KLB complex | FGF21FGFR1KLB | P11362Q86Z14Q9NSA1 | 0:0:0 | CORUM | CORUM:6828 | 2224828817452648 |
| FGFR1c-KLB complex | FGFR1KLB | P11362Q86Z14 | 0:0 | CORUM | CORUM:6836 | 17452648 |
| Klotho_FGFR1 | FGFR1KL | P11362Q9UEF7 | 1:1 | CellPhoneDB | CellPhoneDB:Klotho_FGFR1 | |
| CBX5CDR2CDT1CENPEDYNLL1FGFR1OP2GMNNNXF1POGZRPUSD2SLMAPTLK2UBQLN1ZMYM3 | O75496P45973P63167Q01850Q02224Q14202Q14BN4Q7Z3K3Q86UE8Q8IZ73Q9H211Q9NVK5Q9UBU9Q9UMX0 | 1:1:1:1:1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC8832 | ||
| CDR2CDT1CENPEDYNLL1FGFR1OP2GMNNNXF1POGZRPUSD2SLMAPTLK2UBQLN1ZMYM4 | O75496P63167Q01850Q02224Q14BN4Q5VZL5Q7Z3K3Q86UE8Q8IZ73Q9H211Q9NVK5Q9UBU9Q9UMX0 | 1:1:1:1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC7347 | ||
| FGF1FGFR1 | P05230P11362 | 2:2 | PDB | PDB:3ojvPDB:1evt | ||
| FGF2FGFR1 | P09038P11362 | 2:2 | PDB | PDB:1cvsPDB:1fq9 | ||
| FGFR1 | P11362 | 2 | PDB | PDB:3js2PDB:7ozdPDB:4f65PDB:4f64PDB:4uwcPDB:5b7vPDB:4rwlPDB:4v04PDB:4rwiPDB:6mzwPDB:5am7PDB:6c1cPDB:6c1oPDB:6c18PDB:6nvlPDB:9cd5PDB:8xz7PDB:4nkaPDB:4rwjPDB:6c1bPDB:4wunPDB:4nk9PDB:1agwPDB:5ew8PDB:4rwkPDB:5ur1PDB:5vndPDB:2fgiPDB:5uq0PDB:3gqlPDB:6p69PDB:8y22PDB:6mzqPDB:1fgkPDB:5flfPDB:8jmzPDB:3ky2PDB:3kxxPDB:6c19PDB:5z0sPDB:7ozbPDB:6itjPDB:4uwyPDB:4nksPDB:4uwbPDB:8xloPDB:3c4fPDB:6p68PDB:1fgiPDB:8ykiPDB:4v05PDB:4f63PDB:5o49PDB:5a4cPDB:4v01PDB:7wclPDB:3rhxPDB:5am6PDB:5zv2PDB:7ozfPDB:5o4aPDB:5a46PDB:4zsaPDB:3tt0 | ||
| FGFR1PLCG2 | P11362P16885 | 1:1 | PDB | PDB:8jqi | ||
| FGF9FGFR1 | P11362P31371 | 1:1 | PDB | PDB:5w59 |
Page 1 of 2Next
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 27863537 |
Sequence, Structure & Domains
Sequences
Length
822
Mass
91,868
Sequence
MWSWKCLLFWAVLVTATLCTARPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSDALPSSEDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIVYKMKSGTKKSDFHSQMAVHKLAKSIPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSFPDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR
Alternative Products
Event=Alternative splicing; Named isoforms=21; Name=1; Synonyms=Alpha A1, IV; IsoId=P11362-1; Sequence=Displayed; Name=2; Synonyms=Alpha A2; IsoId=P11362-8; Sequence=VSP_009842, VSP_009843; Name=3; Synonyms=Alpha A3; IsoId=P11362-17; Sequence=VSP_009836, VSP_009837; Name=4; Synonyms=Alpha B1; IsoId=P11362-2; Sequence=VSP_002960; Name=5; Synonyms=Alpha B2; IsoId=P11362-9; Sequence=VSP_002960, VSP_009842, VSP_009843; Name=6; Synonyms=Beta A1, II, H2; IsoId=P11362-3; Sequence=VSP_002958; Name=7; Synonyms=Beta A2; IsoId=P11362-10; Sequence=VSP_002958, VSP_009842, VSP_009843; Name=8; Synonyms=Beta B1; IsoId=P11362-4; Sequence=VSP_002958, VSP_002960; Name=9; Synonyms=Beta B2; IsoId=P11362-11; Sequence=VSP_002958, VSP_002960, VSP_009842, VSP_009843; Name=10; Synonyms=Gamma A1; IsoId=P11362-5; Sequence=VSP_002957; Name=11; Synonyms=Gamma A2; IsoId=P11362-12; Sequence=VSP_002957, VSP_009842, VSP_009843; Name=12; Synonyms=Gamma B1; IsoId=P11362-6; Sequence=VSP_002957, VSP_002960; Name=13; Synonyms=Gamma B2; IsoId=P11362-13; Sequence=VSP_002957, VSP_002960, VSP_009842, VSP_009843; Name=14; Synonyms=A, III; IsoId=P11362-7; Sequence=VSP_002959; Name=15; Synonyms=I, H3; IsoId=P11362-14; Sequence=VSP_002958, VSP_002959; Name=16; Synonyms=V; IsoId=P11362-15; Sequence=VSP_009838, VSP_009839; Name=17; Synonyms=H4; IsoId=P11362-16; Sequence=VSP_002958, VSP_009840, VSP_009841; Name=18; Synonyms=H5; IsoId=P11362-18; Sequence=VSP_002958, VSP_002959, VSP_009840, VSP_009841; Name=19; IsoId=P11362-19; Sequence=VSP_038470, VSP_002959, VSP_038471; Name=20; IsoId=P11362-20; Sequence=VSP_041916, VSP_041918; Name=21; IsoId=P11362-21; Sequence=VSP_041917, VSP_002959
Alternative Sequence
1..160; Missing (in isoform 10, isoform 11, isoform 12 and isoform 13); 1..30; MWSWKCLLFWAVLVTATLCTARPSPTLPEQ -> MAAVTRDFGEMLLHSGRVLPAE (in isoform 20); 1; M -> MEARVSLKRRIELTVEYPWRCGALSPTSNCRTGM (in isoform 21); 31..119; Missing (in isoform 6, isoform 7, isoform 8, isoform 9, isoform 15, isoform 17 and isoform 18); 32..61; QPWGAPVEVESFLVHPGDLLQLRCRLRDDV -> CPDLQEAKSCSASFHSITPLPFGLGTRLSD (in isoform 3); 62..822; Missing (in isoform 3); 119; S -> SVPI (in isoform 19); 120..150; DALPSSEDDDDDDDSSSEEKETDNTKPNRMP -> ACPDLQEAKWCSASFHSITPLPFGLGTRLSD (in isoform 16); 148..149; Missing (in isoform 14, isoform 15, isoform 18, isoform 19 and isoform 21); 151..822; Missing (in isoform 16); 313..391; TAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLEIIIYCTGAFLISCMV -> VIMAPVFVGQSTGKETTVSGAQVPVGRLSCPRMGSFLTLQAHTLHLSRDLATSPRTSNRGHKVEVSWEQRAAGMGGAGL (in isoform 17 and isoform 18); 313..360; TAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLE -> HSGINSSDAEVLTLFNVTEAQSGEYVCKVSNYIGEANQSAWLTVTRP (in isoform 19); 392..822; Missing (in isoform 17 and isoform 18); 427..428; Missing (in isoform 20); 428..429; Missing (in isoform 4, isoform 5, isoform 8, isoform 9, isoform 12 and isoform 13); 619..662; CIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRL -> VWNLKAPLVHTPRPGSQECPGDRGQCDEDSRLWPRTGHSPHRLL (in isoform 2, isoform 5, isoform 7, isoform 9, isoform 11 and isoform 13); 663..822; Missing (in isoform 2, isoform 5, isoform 7, isoform 9, isoform 11 and isoform 13)
3D Structural Models
Turn
93..95; 210..213; 461..463; 469..471
Helix
159..161; 199..201; 222..224; 320..323; 475..477; 522..538; 569..574; 591..593; 597..616; 626..628; 648..650; 663..666; 669..674; 679..694; 706..714; 727..736; 741..743; 747..760
Beta Strand
40..42; 51..54; 63..72; 77..81; 83..88; 97..105; 108..116; 151..156; 165..169; 174..177; 180..184; 187..192; 207..209; 214..217; 226..234; 237..248; 265..268; 269..271; 273..276; 286..293; 296..300; 302..304; 307..313; 316..318; 325..328; 333..335; 337..345; 348..359; 478..486; 488..499; 501..503; 508..516; 547..551; 553..555; 558..562; 579..583; 584..586; 629..631; 637..639; 641..643; 653..655; 658..660; 676..678; 722..724
3D Structure
Electron microscopy (2); NMR spectroscopy (2); X-ray crystallography (75)
Domain & Motif Annotations
Compositional Bias
125..135; Acidic residues; 136..145; Basic and acidic residues; 778..792; Polar residues
Domain (CC)
The second and third Ig-like domains directly interact with fibroblast growth factors (FGF) and heparan sulfate proteoglycans. Isoforms lacking the first Ig-like domain have higher affinity for fibroblast growth factors (FGF) and heparan sulfate proteoglycans than isoforms with all three Ig-like domains.
Domain (FT)
25..119; Ig-like C2-type 1; 158..246; Ig-like C2-type 2; 255..357; Ig-like C2-type 3; 478..767; Protein kinase
Region
120..154; Disordered; 160..177; Heparin-binding; 778..822; Disordered
Protein Families
- Protein kinase superfamily
- Tyr protein kinase family
- Fibroblast growth factor receptor subfamily
Sequence Similarities
Belongs to the protein kinase superfamily. Tyr protein kinase family. Fibroblast growth factor receptor subfamily.
Clinical Relevance
Disease Involvement
Cancer-related genesCraniosynostosisDisease variantDwarfismFDA approved drug targetsHoloprosencephalyHypogonadotropic hypogonadismIntellectual disabilityKallmann syndrome
Related Diseases
Acute diabete complicationAcute myeloid leukaemiaAlzheimer diseaseBladder cancerBreast cancerChronic arterial occlusive diseaseColorectal cancerCoronary atherosclerosisEndometrial cancerEpidermal dysplasiasGram-positive bacterial infectionIdiopathic interstitial pneumonitisLiver cancerLung cancerMultiple myelomaMyelodysplastic syndromeMyeloproliferative neoplasmNon-alcoholic fatty liver diseaseOesophagitisOvarian cancerPeritoneal cancerRetina cancerSolid tumour/cancerStomach cancerThrombocytopeniaType 2 diabetes mellitus
Biomarker
Phase 3; Phase 1; Phase 1/2; Phase 2; Investigative; Approved; Terminated
Drug Targets
FDA approved drug targets
Drugs
AVUTOMETINIBPD-0166285LUCITANIBNINTEDANIB ESYLATEINFIGRATINIBNULLMUPARFOSTATALPELISIBOLVEREMBATINIBGW843682XXL999TOZASERTIBARSENIC TRIOXIDEGW441756XBRIVANIBFEXAGRATINIBTG100-801XL228ZOTATIFINMIDOSTAURINDERAZANTINIBPAZOPANIBGUNAGRATINIBMK-2461PD173074PALIFERMINDEHYDRATED ALCOHOLRG-1530VANDETANIBAST-487GO-6976DOCETAXEL ANHYDROUSCARBOPLATINHMPL-453ALISERTIBFGFR INHIBITOR CPL304110PONATINIBALSTERPAULLONEMASITINIBRABEPRAZOLECHEMBL:CHEMBL578061ZOLIGRATINIBFP-1039PEMIGATINIBTRAMETINIB DIMETHYL SULFOXIDECP-547632MLN-8054AFIMOXIFENELENVATINIBODM-203CISPLATINREGORAFENIBPICTILISIBERDAFITINIBENMD-981693VARGATEFTASURGRATINIBROGARATINIBAZD8055SORAFENIBBUPARLISIBAZD-4547ENMD-2076BRIGATINIBCENISERTIBFUTIBATINIBCHEMBL:CHEMBL546797DOVITINIBNVP-TAE684SP-600125ROMIPLOSTIMLORLATINIBSULFATINIBLY-2874455ENTRECTINIBHESPERADINFGFR/CSF-1R INHIBITOR 3D185VISTUSERTIBPACLITAXELTAMATINIBILORASERTIBFINASTERIDECHEMBL:CHEMBL459729TOPICAL POTASSIUM DOBESILATEMEK INHIBITOR RO4987655PRN1371ORANTINIBCP-459632FGFR INHIBITOR DEBIO 1347TRAFERMINDASATINIB ANHYDROUSSELUMETINIBETOPOSIDEXL-999CEDIRANIBFGF-1SUNITINIBFGF RECEPTOR ANTAGONIST HGS1036PHA-665752SIROLIMUSJNJ-7706621BRIVANIB ALANINATEVACCINEINFIGRATINIB PHOSPHATECYC-116PF-562271KW-2449
Interaction Protein
ENSG00000011201ENSG00000039068ENSG00000066468ENSG00000069869ENSG00000096384ENSG00000113578ENSG00000118972ENSG00000124181ENSG00000138685ENSG00000160867ENSG00000168036ENSG00000178394
Interaction Count
12
Interaction Dataset
intact_biogrid