Protein detail
FGFR1
Fibroblast growth factor receptor 1 (FGFR-1) (EC 2.7.10.1) (Basic fibroblast growth factor receptor 1) (BFGFR) (bFGF-R-1) (Fms-like tyrosine kinase 2) (FLT-2) (N-sam) (Proto-oncogene c-Fgr) (CD antigen CD331)
Entry name FGFR1 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification Cancer-related genesCD markersDisease related genesEnzymesFDA approved drug targetsHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsRAS pathway related proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Fibroblast growth factor receptor 1 (FGFR-1) (EC 2.7.10.1) (Basic fibroblast growth factor receptor 1) (BFGFR) (bFGF-R-1) (Fms-like tyrosine kinase 2) (FLT-2) (N-sam) (Proto-oncogene c-Fgr) (CD antigen CD331)
Protein Class (11)
Cancer-related genesCD markersDisease related genesEnzymesFDA approved drug targetsHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsRAS pathway related proteinsTransporters
Protein Function (14)
- Predicted intracellular proteins
- Human disease related genes:Congenital malformations:Congenital malformations of the musculoskeletal system
- ENZYME proteins:Transferases
- Human disease related genes:Cancers:Cancers of the breast and female genital organs
- Human disease related genes:Endocrine and metabolic diseases:Hypothalamus and pituitary gland diseases
- CD markers
- RAS pathway related proteins
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
- Transporters:Accessory Factors Involved in Transport
Page 1 of 2
Transmembrane
377..397; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (11)
BFGFRCD331CEKFLGFLT2H2H3H4H5KAL2N-SAM
Gene Description
Fibroblast growth factor receptor 1
Chromosome
8
Position
38400215-38468834
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Function & Pathway
Protein Function (14)
- Predicted intracellular proteins
- Human disease related genes:Congenital malformations:Congenital malformations of the musculoskeletal system
- ENZYME proteins:Transferases
- Human disease related genes:Cancers:Cancers of the breast and female genital organs
- Human disease related genes:Endocrine and metabolic diseases:Hypothalamus and pituitary gland diseases
- CD markers
- RAS pathway related proteins
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
- Transporters:Accessory Factors Involved in Transport
Page 1 of 2
Cellular Component (9)
Molecular Function (10)
- GO:0004713 protein tyrosine kinase activity
- GO:0005007 fibroblast growth factor receptor activity
- GO:0005515 protein binding
- GO:0005524 ATP binding
- GO:0008201 heparin binding
- GO:0017134 fibroblast growth factor binding
- GO:0042169 SH2 domain binding
- GO:0042802 identical protein binding
- GO:0042803 protein homodimerization activity
- GO:0090722 receptor-receptor interaction
KEGG (18)
- hsa04010 MAPK signaling pathway
- KEGG:hsa04014 Ras signaling pathway
- KEGG:hsa04015 Rap1 signaling pathway
- KEGG:hsa04020 Calcium signaling pathway
- KEGG:hsa04151 PI3K-Akt signaling pathway
- KEGG:hsa04517 IgSF CAM signaling
- KEGG:hsa04519 Cadherin signaling
- KEGG:hsa04520 Adherens junction
- KEGG:hsa04550 Signaling pathways regulating pluripotency of stem cells
- KEGG:hsa04714 Thermogenesis
Page 1 of 2
Reactome (34)
- R-hsa-2219530 constitutive signaling by aberrant pi3k in cancer
- R-hsa-5663202 diseases of signal transduction by growth factor receptors and second messengers
- R-hsa-5654687 downstream signaling of activated fgfr1
- R-hsa-9758919 epithelial mesenchymal transition emt during gastrulation
- R-hsa-190370 fgfr1b ligand binding and activation
- R-hsa-190373 fgfr1c ligand binding and activation
- R-hsa-190242 fgfr1 ligand binding and activation
- R-hsa-1839124 fgfr1 mutant receptor activation
- R-hsa-9793380 formation of paraxial mesoderm
- R-hsa-5654693 frs mediated fgfr1 signaling
Page 1 of 4
Mediation Categories (5)
Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence127
Enzyme-Mediated Modification (23)
23 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| FGFR1 | EGFR | P00533 | Y | 730 | phosphorylation | KEA | KEA:17570479 |
| FGFR1 | IGF1R | P08069 | Y | 653 | phosphorylation | KEA | KEA:17570479 |
| FGFR1 | INSR | P06213 | Y | 654 | phosphorylation | KEA | KEA:17570479 |
Page 3 of 3Previous
Ligand-Receptor Signaling (68)
68 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| cell_surface | cell_surface | connectomeDB2020 | Yes | ||||
| cell_surface | cell_surface | OmniPath | Yes | ||||
| receptor | receptor | talklr | Yes | Yes | |||
| receptor | receptor | Cellinker | Yes | Yes | |||
| receptor | receptor | scConnect | Yes | Yes | |||
| receptor | receptor | connectomeDB2020 | Yes | Yes | |||
| receptor | receptor | CellCall | Yes | Yes | |||
| receptor | receptor | iTALK | Yes | Yes | |||
| growth_factor | receptor | iTALK | Yes | Yes | |||
| receptor | receptor | Almen2009 | Yes | Yes |
Regulatory Interaction Network (23)
23 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| FGFR1 | P11362 | PGAM1 | P18669 | Yes | Yes | REACH_ProtMapperSIGNORSparser_ProtMapperProtMapper | ProtMapper:30087897SIGNOR:23653202 | |
| FGF5 | P12034 | FGFR1 | P11362 | Yes | Yes | iTALKICELLNETSIGNORProtMapperDIPHPMR_talklrCellChatDBHPRD_LRdbDLRP_CellinkertalklrHPRDRamilowski2015_Baccin2019DLRP_talklrWangRamilowski2015HPMR_LRdbCellPhoneDBHPRD_talklrBaccin2019CellinkerEMBRACECellCallCellTalkDBFantom5_LRdbHPMR_CellinkerconnectomeDB2020Reactome_ProtMapperLRdb | CellTalkDB:16597617Cellinker:25772309connectomeDB2020:8386828ICELLNET:25772309HPRD:8386828Baccin2019:83868288386828SIGNOR:8386828Cellinker:16597617LRdb:16597617DIP:8386828 | |
| MK03 | P27361 | FGFR1 | P11362 | Yes | Yes | WangSparser_ProtMapperPhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperSIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:27342992ProtMapper:23405013PhosphoSite:18411303SIGNOR:23405013 | |
| FGFR1 | P11362 | LDHA | P00338 | Yes | Yes | Sparser_ProtMapperPhosphoSite_MIMPMIMPHPRD_MIMPPhosphoSite_norefSIGNORiPTMnetProtMapperSIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:32572027PhosphoSite:21969607ProtMapper:33987181ProtMapper:21969607PhosphoSite:34452627PhosphoSite:28218905SIGNOR:21969607PhosphoSite:33572095ProtMapper:28516914 | |
| MK14 | Q16539 | FGFR1 | P11362 | Yes | Yes | Sparser_ProtMapperPhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperRLIMS-P_ProtMapperKinexus_KEAKEAACSNSIGNOR_ProtMapperPhosphoSite_ProtMapper | ACSN:18039929ProtMapper:20626350KEA:18411303ProtMapper:18411303ACSN:12738796ACSN:11274345ACSN:15187187SIGNOR:20626350 | |
| KPCE | Q02156 | FGFR1 | P11362 | Yes | Yes | Yes | PhosphoSite_MIMPMIMPPhosphoSite_norefSIGNORiPTMnetProtMapperACSNSIGNOR_ProtMapperPhosphoSite_ProtMapper | ACSN:11313945ACSN:15567848ProtMapper:23564461ACSN:11940581ACSN:17496910ACSN:14585353ACSN:21386996SIGNOR:23564461ACSN:19568798ACSN:19615955ACSN:16488589ACSN:6321473ACSN:12845332ACSN:12040186ACSN:8321321ACSN:11447289 |
| KS6A3 | P51812 | FGFR1 | P11362 | Yes | Yes | Sparser_ProtMapperiPTMnetSIGNORProtMapperRLIMS-P_ProtMapperHINTLit-BM-17PhosphoSitePhosphoSite_ProtMapper | ProtMapper:24141780Lit-BM-17:24141780HINT:24141780SIGNOR:24141780HINT:32707033ProtMapper:31146385ProtMapper:30577533HINT:33961781PhosphoSite:24141780 | |
| FGFR1 | P11362 | THIL | P24752 | Yes | Yes | Sparser_ProtMapperiPTMnetSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:27867011ProtMapper:27867011ProtMapper:33808495SIGNOR:27867011 | |
| FGFR1 | P11362 | SRC8 | Q14247 | Yes | Yes | PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperPhosphoSite_KEAKEAphosphoELM_KEAphosphoELMSIGNOR_ProtMapper | phosphoELM:12601080KEA:15951569KEA:15592455SIGNOR:12601080ProtMapper:12601080KEA:12601080 | |
| DUS26 | Q9BV47 | FGFR1 | P11362 | Yes | Yes | SIGNOR | SIGNOR:28701747 |
Protein Complex Composition (12)
12 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| FGF21-FGFR1c-KLB complex | FGF21FGFR1KLB | P11362Q86Z14Q9NSA1 | 0:0:0 | CORUM | CORUM:6828 | 2224828817452648 |
| FGFR1c-KLB complex | FGFR1KLB | P11362Q86Z14 | 0:0 | CORUM | CORUM:6836 | 17452648 |
| Klotho_FGFR1 | FGFR1KL | P11362Q9UEF7 | 1:1 | CellPhoneDB | CellPhoneDB:Klotho_FGFR1 | |
| CBX5CDR2CDT1CENPEDYNLL1FGFR1OP2GMNNNXF1POGZRPUSD2SLMAPTLK2UBQLN1ZMYM3 | O75496P45973P63167Q01850Q02224Q14202Q14BN4Q7Z3K3Q86UE8Q8IZ73Q9H211Q9NVK5Q9UBU9Q9UMX0 | 1:1:1:1:1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC8832 | ||
| CDR2CDT1CENPEDYNLL1FGFR1OP2GMNNNXF1POGZRPUSD2SLMAPTLK2UBQLN1ZMYM4 | O75496P63167Q01850Q02224Q14BN4Q5VZL5Q7Z3K3Q86UE8Q8IZ73Q9H211Q9NVK5Q9UBU9Q9UMX0 | 1:1:1:1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC7347 | ||
| FGF1FGFR1 | P05230P11362 | 2:2 | PDB | PDB:3ojvPDB:1evt | ||
| FGF2FGFR1 | P09038P11362 | 2:2 | PDB | PDB:1cvsPDB:1fq9 | ||
| FGFR1 | P11362 | 2 | PDB | PDB:3js2PDB:7ozdPDB:4f65PDB:4f64PDB:4uwcPDB:5b7vPDB:4rwlPDB:4v04PDB:4rwiPDB:6mzwPDB:5am7PDB:6c1cPDB:6c1oPDB:6c18PDB:6nvlPDB:9cd5PDB:8xz7PDB:4nkaPDB:4rwjPDB:6c1bPDB:4wunPDB:4nk9PDB:1agwPDB:5ew8PDB:4rwkPDB:5ur1PDB:5vndPDB:2fgiPDB:5uq0PDB:3gqlPDB:6p69PDB:8y22PDB:6mzqPDB:1fgkPDB:5flfPDB:8jmzPDB:3ky2PDB:3kxxPDB:6c19PDB:5z0sPDB:7ozbPDB:6itjPDB:4uwyPDB:4nksPDB:4uwbPDB:8xloPDB:3c4fPDB:6p68PDB:1fgiPDB:8ykiPDB:4v05PDB:4f63PDB:5o49PDB:5a4cPDB:4v01PDB:7wclPDB:3rhxPDB:5am6PDB:5zv2PDB:7ozfPDB:5o4aPDB:5a46PDB:4zsaPDB:3tt0 | ||
| FGFR1PLCG2 | P11362P16885 | 1:1 | PDB | PDB:8jqi | ||
| FGF9FGFR1 | P11362P31371 | 1:1 | PDB | PDB:5w59 |
Page 1 of 2Next
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 27863537 |
Sequence, Structure & Domains
Sequences
Length
822
Mass
91,868
Sequence
MWSWKCLLFWAVLVTATLCTARPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSDALPSSEDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIVYKMKSGTKKSDFHSQMAVHKLAKSIPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSFPDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR
Alternative Products
Event=Alternative splicing; Named isoforms=21; Name=1; Synonyms=Alpha A1, IV; IsoId=P11362-1; Sequence=Displayed; Name=2; Synonyms=Alpha A2; IsoId=P11362-8; Sequence=VSP_009842, VSP_009843; Name=3; Synonyms=Alpha A3; IsoId=P11362-17; Sequence=VSP_009836, VSP_009837; Name=4; Synonyms=Alpha B1; IsoId=P11362-2; Sequence=VSP_002960; Name=5; Synonyms=Alpha B2; IsoId=P11362-9; Sequence=VSP_002960, VSP_009842, VSP_009843; Name=6; Synonyms=Beta A1, II, H2; IsoId=P11362-3; Sequence=VSP_002958; Name=7; Synonyms=Beta A2; IsoId=P11362-10; Sequence=VSP_002958, VSP_009842, VSP_009843; Name=8; Synonyms=Beta B1; IsoId=P11362-4; Sequence=VSP_002958, VSP_002960; Name=9; Synonyms=Beta B2; IsoId=P11362-11; Sequence=VSP_002958, VSP_002960, VSP_009842, VSP_009843; Name=10; Synonyms=Gamma A1; IsoId=P11362-5; Sequence=VSP_002957; Name=11; Synonyms=Gamma A2; IsoId=P11362-12; Sequence=VSP_002957, VSP_009842, VSP_009843; Name=12; Synonyms=Gamma B1; IsoId=P11362-6; Sequence=VSP_002957, VSP_002960; Name=13; Synonyms=Gamma B2; IsoId=P11362-13; Sequence=VSP_002957, VSP_002960, VSP_009842, VSP_009843; Name=14; Synonyms=A, III; IsoId=P11362-7; Sequence=VSP_002959; Name=15; Synonyms=I, H3; IsoId=P11362-14; Sequence=VSP_002958, VSP_002959; Name=16; Synonyms=V; IsoId=P11362-15; Sequence=VSP_009838, VSP_009839; Name=17; Synonyms=H4; IsoId=P11362-16; Sequence=VSP_002958, VSP_009840, VSP_009841; Name=18; Synonyms=H5; IsoId=P11362-18; Sequence=VSP_002958, VSP_002959, VSP_009840, VSP_009841; Name=19; IsoId=P11362-19; Sequence=VSP_038470, VSP_002959, VSP_038471; Name=20; IsoId=P11362-20; Sequence=VSP_041916, VSP_041918; Name=21; IsoId=P11362-21; Sequence=VSP_041917, VSP_002959
Alternative Sequence
1..160; Missing (in isoform 10, isoform 11, isoform 12 and isoform 13); 1..30; MWSWKCLLFWAVLVTATLCTARPSPTLPEQ -> MAAVTRDFGEMLLHSGRVLPAE (in isoform 20); 1; M -> MEARVSLKRRIELTVEYPWRCGALSPTSNCRTGM (in isoform 21); 31..119; Missing (in isoform 6, isoform 7, isoform 8, isoform 9, isoform 15, isoform 17 and isoform 18); 32..61; QPWGAPVEVESFLVHPGDLLQLRCRLRDDV -> CPDLQEAKSCSASFHSITPLPFGLGTRLSD (in isoform 3); 62..822; Missing (in isoform 3); 119; S -> SVPI (in isoform 19); 120..150; DALPSSEDDDDDDDSSSEEKETDNTKPNRMP -> ACPDLQEAKWCSASFHSITPLPFGLGTRLSD (in isoform 16); 148..149; Missing (in isoform 14, isoform 15, isoform 18, isoform 19 and isoform 21); 151..822; Missing (in isoform 16); 313..391; TAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLEIIIYCTGAFLISCMV -> VIMAPVFVGQSTGKETTVSGAQVPVGRLSCPRMGSFLTLQAHTLHLSRDLATSPRTSNRGHKVEVSWEQRAAGMGGAGL (in isoform 17 and isoform 18); 313..360; TAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLE -> HSGINSSDAEVLTLFNVTEAQSGEYVCKVSNYIGEANQSAWLTVTRP (in isoform 19); 392..822; Missing (in isoform 17 and isoform 18); 427..428; Missing (in isoform 20); 428..429; Missing (in isoform 4, isoform 5, isoform 8, isoform 9, isoform 12 and isoform 13); 619..662; CIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRL -> VWNLKAPLVHTPRPGSQECPGDRGQCDEDSRLWPRTGHSPHRLL (in isoform 2, isoform 5, isoform 7, isoform 9, isoform 11 and isoform 13); 663..822; Missing (in isoform 2, isoform 5, isoform 7, isoform 9, isoform 11 and isoform 13)
3D Structural Models
Turn
93..95; 210..213; 461..463; 469..471
Helix
159..161; 199..201; 222..224; 320..323; 475..477; 522..538; 569..574; 591..593; 597..616; 626..628; 648..650; 663..666; 669..674; 679..694; 706..714; 727..736; 741..743; 747..760
Beta Strand
40..42; 51..54; 63..72; 77..81; 83..88; 97..105; 108..116; 151..156; 165..169; 174..177; 180..184; 187..192; 207..209; 214..217; 226..234; 237..248; 265..268; 269..271; 273..276; 286..293; 296..300; 302..304; 307..313; 316..318; 325..328; 333..335; 337..345; 348..359; 478..486; 488..499; 501..503; 508..516; 547..551; 553..555; 558..562; 579..583; 584..586; 629..631; 637..639; 641..643; 653..655; 658..660; 676..678; 722..724
3D Structure
Electron microscopy (2); NMR spectroscopy (2); X-ray crystallography (75)
Domain & Motif Annotations
Compositional Bias
125..135; Acidic residues; 136..145; Basic and acidic residues; 778..792; Polar residues
Domain (CC)
The second and third Ig-like domains directly interact with fibroblast growth factors (FGF) and heparan sulfate proteoglycans. Isoforms lacking the first Ig-like domain have higher affinity for fibroblast growth factors (FGF) and heparan sulfate proteoglycans than isoforms with all three Ig-like domains.
Domain (FT)
25..119; Ig-like C2-type 1; 158..246; Ig-like C2-type 2; 255..357; Ig-like C2-type 3; 478..767; Protein kinase
Region
120..154; Disordered; 160..177; Heparin-binding; 778..822; Disordered
Protein Families (3)
- Protein kinase superfamily
- Tyr protein kinase family
- Fibroblast growth factor receptor subfamily
Sequence Similarities
Belongs to the protein kinase superfamily. Tyr protein kinase family. Fibroblast growth factor receptor subfamily.
Clinical Relevance
Disease Involvement (9)
Cancer-related genesCraniosynostosisDisease variantDwarfismFDA approved drug targetsHoloprosencephalyHypogonadotropic hypogonadismIntellectual disabilityKallmann syndrome
Related Diseases (32)
CraniosynostosisDwarfismHoloprosencephalyHypogonadotropic hypogonadismIntellectual disabilityKallmann syndromeAcute diabetic complicationAcute myeloid leukaemiaAlzheimer diseaseBladder cancerBreast cancerChronic arterial occlusive diseaseColorectal cancerCoronary atherosclerosisEndometrial cancerEpidermal dysplasiasGram-positive bacterial infectionIdiopathic interstitial pneumonitisLiver cancerLung cancerMultiple myelomaMyelodysplastic syndromeMyeloproliferative neoplasmNon-alcoholic fatty liver diseaseOesophagitisOvarian cancerPeritoneal cancerRetina cancerSolid tumour/cancerStomach cancerThrombocytopeniaType 2 diabetes mellitus
Biomarker
Phase 3; Phase 1; Phase 1/2; Phase 2; Investigative; Approved; Terminated
Drug Targets
FDA approved drug targets
Drugs (107)
AVUTOMETINIBPD-0166285LUCITANIBNINTEDANIB ESYLATEINFIGRATINIBNULLMUPARFOSTATALPELISIBOLVEREMBATINIBGW843682XXL999TOZASERTIBARSENIC TRIOXIDEGW441756XBRIVANIBFEXAGRATINIBTG100-801XL228ZOTATIFINMIDOSTAURINDERAZANTINIBPAZOPANIBGUNAGRATINIBMK-2461PD173074PALIFERMINDEHYDRATED ALCOHOLRG-1530VANDETANIBAST-487GO-6976DOCETAXEL ANHYDROUSCARBOPLATINHMPL-453ALISERTIBFGFR INHIBITOR CPL304110PONATINIBALSTERPAULLONEMASITINIBRABEPRAZOLECHEMBL:CHEMBL578061ZOLIGRATINIBFP-1039PEMIGATINIBTRAMETINIB DIMETHYL SULFOXIDECP-547632MLN-8054AFIMOXIFENELENVATINIBODM-203CISPLATINREGORAFENIBPICTILISIBERDAFITINIBENMD-981693VARGATEFTASURGRATINIBROGARATINIBAZD8055SORAFENIBBUPARLISIBAZD-4547ENMD-2076BRIGATINIBCENISERTIBFUTIBATINIBCHEMBL:CHEMBL546797DOVITINIBNVP-TAE684SP-600125ROMIPLOSTIMLORLATINIBSULFATINIBLY-2874455ENTRECTINIBHESPERADINFGFR/CSF-1R INHIBITOR 3D185VISTUSERTIBPACLITAXELTAMATINIBILORASERTIBFINASTERIDECHEMBL:CHEMBL459729TOPICAL POTASSIUM DOBESILATEMEK INHIBITOR RO4987655PRN1371ORANTINIBCP-459632FGFR INHIBITOR DEBIO 1347TRAFERMINDASATINIB ANHYDROUSSELUMETINIBETOPOSIDEXL-999CEDIRANIBFGF-1SUNITINIBFGF RECEPTOR ANTAGONIST HGS1036PHA-665752SIROLIMUSJNJ-7706621BRIVANIB ALANINATEVACCINEINFIGRATINIB PHOSPHATECYC-116PF-562271KW-2449
Interaction Protein (12)
ENSG00000011201ENSG00000039068ENSG00000066468ENSG00000069869ENSG00000096384ENSG00000113578ENSG00000118972ENSG00000124181ENSG00000138685ENSG00000160867ENSG00000168036ENSG00000178394
Interaction Count
12
Interaction Dataset
intact_biogrid
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 30646616 | Preferential Localization of MUC1 Glycoprotein in Exosomes Secreted by Non-Small Cell Lung Carcinoma Cells. | THBS1, ANXA6, HIST1H4A, COL18A1, MDK, SRGN, ENO1, TUBA4A, SLC3A2, GPI, MIF, MUC1, TALDO1, SLC7A5, ICAM1, HSP90AA1, G6PD, and LRP1 were found to be expressed in exosomes at more than 5-fold higher level as compared to total cellular membrane proteins. |