Protein detail
CD79A
B-cell antigen receptor complex-associated protein alpha chain (Ig-alpha) (MB-1 membrane glycoprotein) (Membrane-bound immunoglobulin-associated protein) (Surface IgM-associated protein) (CD antigen CD79a)
Entry name CD79A | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 2 | Transmembrane count 1 | Protein classification Cancer-related genesCD markersDisease related genesHuman disease related genesPredicted intracellular proteinsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
B-cell antigen receptor complex-associated protein alpha chain (Ig-alpha) (MB-1 membrane glycoprotein) (Membrane-bound immunoglobulin-associated protein) (Surface IgM-associated protein) (CD antigen CD79a)
Protein Class (6)
Cancer-related genesCD markersDisease related genesHuman disease related genesPredicted intracellular proteinsPredicted membrane proteins
Protein Function (6)
- Predicted intracellular proteins
- CD markers
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Human disease related genes:Cancers:Cancers of haematopoietic and lymphoid tissues
- Cancer-related genes
- Disease related genes
Transmembrane
144..165; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
Ig-alphaIGAIGAlphaMB-1MB1
Gene Description
CD79a molecule
Chromosome
19
Position
41877279-41881372
Supporting publications (n)
2
EVMP confidence score
0.53
Fluorescence & Localization
Tissue SpecificbrainCell SpecificAstrocytesSingle-Nuclei Brain SpecificastrocyteBlood Cell Specificplasmacytoid DCBlood Lineage SpecificB-cells
Function & Pathway
Protein Function (6)
- Predicted intracellular proteins
- CD markers
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Human disease related genes:Cancers:Cancers of haematopoietic and lymphoid tissues
- Cancer-related genes
- Disease related genes
Cellular Component (6)
Molecular Function (3)
Biological Process (3)
Reactome (8)
- R-hsa-1280218 adaptive immune system
- R-hsa-983695 antigen activates b cell receptor bcr leading to generation of second messengers
- R-hsa-5690714 cd22 mediated bcr regulation
- R-hsa-5663205 infectious disease
- R-hsa-9679191 potential therapeutics for sars
- R-hsa-9679506 sars cov infections
- R-hsa-983705 signaling by the b cell receptor bcr
- R-hsa-9824446 viral infection pathways
Mediation Categories (3)
Clinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence69
Enzyme-Mediated Modification (21)
21 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| CD79A | FER | P16591 | Y | 210 | phosphorylation | Li2012 | |
| CD79A | SRC | P12931 | Y | 188 | phosphorylation | Li2012KEA | KEA:17570479 |
| CD79A | SRC | P12931 | Y | 210 | phosphorylation | Li2012 | |
| CD79A | BLK | P51451 | Y | 199 | phosphorylation | Reactome_ProtMapperProtMapper | |
| CD79A | BLK | P51451 | Y | 188 | phosphorylation | Reactome_ProtMapperProtMapper | |
| CD79A | SRMS | Q9H3Y6 | Y | 199 | phosphorylation | Reactome_ProtMapperProtMapper | |
| CD79A | SRMS | Q9H3Y6 | Y | 188 | phosphorylation | Reactome_ProtMapperProtMapper | |
| CD79A | SYK | P43405 | S | 197 | phosphorylation | RLIMS-P_ProtMapperREACH_ProtMapperSparser_ProtMapperProtMapper | ProtMapper:20940318 |
| CD79A | SYK | P43405 | Y | 210 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:30465710 |
| CD79A | INSR | P06213 | Y | 182 | phosphorylation | KEA | KEA:17570479 |
Ligand-Receptor Signaling (42)
42 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | GO_Intercell | Yes | Yes | |||
| receptor | receptor | CellTalkDB | Yes | Yes | |||
| receptor | receptor | Ramilowski2015 | Yes | Yes | |||
| receptor | receptor | LRdb | Yes | Yes | |||
| receptor | receptor | OmniPath | Yes | Yes | |||
| extracellular | extracellular | DGIdb | Yes | ||||
| extracellular | extracellular | OmniPath | Yes | ||||
| intracellular | intracellular | LOCATE | Yes | ||||
| intracellular | intracellular | ComPPI | Yes | ||||
| intracellular | intracellular | GO_Intercell | Yes |
Page 1 of 5Next
Regulatory Interaction Network (3)
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| LYN | P07948 | CD79A | P11912 | Yes | Yes | HPRD_MIMPSIGNORProtMapperPhosphoSite_KEAphosphoELM_KEAPhosphoNetworksHPRDWangNetworKIN_KEAHPRD-phosphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetPhosphoPointKEAHPRD_KEAphosphoELMSIGNOR_ProtMapperREACH_ProtMapperNetPathReactome_ProtMapperSPIKE_LCSPIKE | SPIKE_LC:10748115SPIKE:10748115HPRD:9531288phosphoELM:9531288SPIKE_LC:1506682ProtMapper:9531288ProtMapper:8193541KEA:9531288KEA:17570479SIGNOR:9531288NetPath:8183901SPIKE:1506682HPRD-phos:9531288 | |
| FYN | P06241 | CD79A | P11912 | Yes | Yes | HPRD_MIMPSIGNORProtMapperPhosphoSite_KEAphosphoELM_KEAPhosphoNetworksHPRDWangNetworKIN_KEAHPRD-phosphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetPhosphoPointKEAHPRD_KEAphosphoELMSIGNOR_ProtMapperNetPathReactome_ProtMapperSPIKE_LCSPIKE | HPRD:9531288phosphoELM:9531288SPIKE_LC:1506682ProtMapper:9531288SIGNOR:9531288KEA:9531288KEA:17570479NetPath:8183901SPIKE:1506682HPRD-phos:9531288 | |
| SH2B1 | Q9NRF2 | CD79A | P11912 | Yes | Yes | SIGNOR | SIGNOR:32323266 |
Protein Complex Composition (2)
Sequence, Structure & Domains
Sequences
Length
226
Mass
25,038
Sequence
MPGGPGVLQALPATIFLLFLLSAVYLGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEKP
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=Long; IsoId=P11912-1; Sequence=Displayed; Name=2; Synonyms=Short; IsoId=P11912-2; Sequence=VSP_002476
Alternative Sequence
89..127; GTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQ -> E (in isoform 2)
3D Structural Models
Helix
34..36; 87..89; 98..100; 142..167
Beta Strand
40..44; 50..52; 63..69; 71..74; 79..83; 91..93; 102..109; 122..125; 134..136; 138..141
3D Structure
Electron microscopy (4); NMR spectroscopy (1)
Domain & Motif Annotations
Domain (CC)
The transmembrane helices of CD79A and CD79B chains and two IgM heavy chains assembly in a four-helix bundle structure that appears to be conserved among different BCR isotypes.
Domain (FT)
33..116; Ig-like C2-type; 177..205; ITAM
Supporting Publications2
| PMID | Title | Related sentences |
|---|---|---|
| 37922300 | Proteomic profiling of urinary extracellular vesicles differentiates breast cancer patients from healthy women. | No related sentences available |
| 40098346 | Toward Identification of Markers for Brain-Derived Extracellular Vesicles in Cerebrospinal Fluid: A Large-Scale, Unbiased Analysis Using Proximity Extension Assays. | No related sentences available |