Protein detail
FCG2A
Low affinity immunoglobulin gamma Fc region receptor II-a (IgG Fc receptor II-a) (CDw32) (Fc-gamma RII-a) (Fc-gamma-RIIa) (FcRII-a) (CD antigen CD32)
Entry name FCG2A | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification CD markersFDA approved drug targetsHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Low affinity immunoglobulin gamma Fc region receptor II-a (IgG Fc receptor II-a) (CDw32) (Fc-gamma RII-a) (Fc-gamma-RIIa) (FcRII-a) (CD antigen CD32)
Protein Class (6)
CD markersFDA approved drug targetsHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins
Protein Function (5)
- Predicted intracellular proteins
- Human disease related genes:Congenital disorders of metabolism:Congenital disorders of ion transport and metabolism
- CD markers
- Human disease related genes:Immune system diseases:Allergies and autoimmune diseases
- FDA approved drug targets:Biotech drugs
Transmembrane
218..240; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (9)
CD32CD32ACDw32Fc-gamma-RIIaFCG2FcgammaRIIaFCGR2FCGR2A1IGFR2
Gene Description
Fc gamma receptor IIa
Chromosome
1
Position
161505430-161524013
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization1
Cell SpecificBreast hormone-responsive cells
Function & Pathway7
Protein Function (5)
- Predicted intracellular proteins
- Human disease related genes:Congenital disorders of metabolism:Congenital disorders of ion transport and metabolism
- CD markers
- Human disease related genes:Immune system diseases:Allergies and autoimmune diseases
- FDA approved drug targets:Biotech drugs
Cellular Component (3)
Molecular Function (3)
Biological Process (3)
KEGG (12)
- hsa04145 Phagosome
- KEGG:hsa04380 Osteoclast differentiation
- KEGG:hsa04611 Platelet activation
- KEGG:hsa04613 Neutrophil extracellular trap formation
- KEGG:hsa04666 Fc gamma R-mediated phagosome formation
- KEGG:hsa05130 Pathogenic Escherichia coli infection
- KEGG:hsa05135 Yersinia infection
- KEGG:hsa05140 Leishmaniasis
- KEGG:hsa05150 Staphylococcus aureus infection
- KEGG:hsa05152 Tuberculosis
Page 1 of 2
Reactome (9)
- R-hsa-9662851 anti inflammatory response favouring leishmania parasite infection
- R-hsa-2029480 fcgamma receptor fcgr dependent phagocytosis
- R-hsa-9664323 fcgr3a mediated il10 synthesis
- R-hsa-2029481 fcgr activation
- R-hsa-5663205 infectious disease
- R-hsa-168249 innate immune system
- R-hsa-9658195 leishmania infection
- R-hsa-6798695 neutrophil degranulation
- R-hsa-2029485 role of phospholipids in phagocytosis
Mediation Categories (3)
Clinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence82
Enzyme-Mediated Modification (35)
35 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| FCGR2A | LYN | P07948 | Y | 280 | phosphorylation | HPRDPhosphoNetworksKEA | HPRD:8756631KEA:8756631 |
| FCGR2A | LYN | P07948 | Y | 287 | phosphorylation | HPRDPhosphoNetworksKEA | HPRD:8756631KEA:8756631 |
| FCGR2A | SYK | P43405 | Y | 288 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPKEAphosphoELMLi2012 | phosphoELM:8756631KEA:8756631 |
| FCGR2A | SYK | P43405 | Y | 281 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEAphosphoELMLi2012SIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | phosphoELM:8756631SIGNOR:8756631KEA:8756631ProtMapper:8756631 |
| FCGR2A | SYK | P43405 | Y | 304 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEAphosphoELMLi2012SIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | phosphoELM:8756631SIGNOR:8756631KEA:8756631ProtMapper:8756631 |
| FCGR2A | SYK | P43405 | Y | 280 | phosphorylation | HPRDPhosphoNetworksKEA | HPRD:8756631KEA:8756631 |
| FCGR2A | SYK | P43405 | Y | 287 | phosphorylation | HPRDPhosphoNetworksKEA | HPRD:8756631KEA:8756631 |
| FCGR2A | SYK | P43405 | Y | 303 | phosphorylation | HPRDKEA | HPRD:8756631KEA:8756631 |
| FCGR2A | BLK | P51451 | Y | 288 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | phosphoELM:8756631SIGNOR:8756631KEA:8756631ProtMapper:8756631 |
| FCGR2A | BLK | P51451 | Y | 281 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPKEAphosphoELM | phosphoELM:8756631KEA:8756631 |
Ligand-Receptor Signaling (40)
40 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | No | No | No | Yes | No |
| cell_surface | cell_surface | Surfaceome | No | No | No | Yes | No |
| cell_surface | cell_surface | OmniPath | No | No | No | Yes | No |
| receptor | receptor | Cellinker | No | Yes | No | Yes | No |
| receptor | receptor | Almen2009 | No | Yes | No | Yes | No |
| receptor | receptor | CellCellInteractions | No | Yes | No | Yes | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | Yes | No |
| transmembrane_phobius | transmembrane_predicted | Almen2009 | No | No | No | Yes | No |
| transmembrane_sosui | transmembrane_predicted | Almen2009 | No | No | No | Yes | No |
| transmembrane_tmhmm | transmembrane_predicted | Almen2009 | No | No | No | Yes | No |
Page 4 of 4Previous
Regulatory Interaction Network (4)
4 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KSYK | P43405 | FCG2A | P12318 | Yes | Yes | No | HPRD_MIMPSIGNORProtMapperHINTPhosphoSite_KEAphosphoELM_KEAInnateDBLi2012PhosphoNetworksHPRDWangPhosphoSite_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPPhosphoSite_norefPhosphoPointiPTMnetKEABioGRIDHPRD_KEAphosphoELMSIGNOR_ProtMapperCellTalkDBLRdbHPRD-phos | phosphoELM:8756631HPRD:8756631KEA:8756631HPRD:9295288HPRD:9280292SIGNOR:8756631CellTalkDB:9632805ProtMapper:8756631HPRD-phos:8756631InnateDB:9268059InnateDB:8663460LRdb:9632805BioGRID:11141335HINT:7487883InnateDB:15136586HINT:15136586HINT:9268059HINT:8663460 |
| BLK | P51451 | FCG2A | P12318 | Yes | Yes | No | PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAphosphoELM_KEAHPRD_KEAphosphoELMSIGNOR_ProtMapperHPRD-phosPhosphoSite_ProtMapper | phosphoELM:8756631HPRD:8756631KEA:8756631SIGNOR:8756631ProtMapper:8756631HPRD-phos:8756631 |
| FYN | P06241 | FCG2A | P12318 | Yes | Yes | No | HPRD_MIMPSIGNORProtMapperPhosphoSite_KEAphosphoELM_KEAPhosphoNetworksHPRDPhosphoSite_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPPhosphoSite_norefPhosphoPointiPTMnetKEAHPRD_KEAphosphoELMSIGNOR_ProtMapperReactome_ProtMapperHPRD-phos | phosphoELM:8756631HPRD:8756631KEA:8756631SIGNOR:8756631ProtMapper:8756631HPRD-phos:8756631 |
| LYN | P07948 | FCG2A | P12318 | Yes | Yes | No | HPRD_MIMPSIGNORProtMapperPhosphoSite_KEAphosphoELM_KEAInnateDBPhosphoNetworksHPRDWangPhosphoSite_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetPhosphoPointKEAHPRD_KEAphosphoELMSIGNOR_ProtMapperReactome_ProtMapperHPRD-phos | phosphoELM:8756631HPRD:8756631KEA:8756631SIGNOR:8756631ProtMapper:8756631HPRD-phos:8756631InnateDB:9268059 |
Protein Complex Composition (2)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 40689422 |
Sequence, Structure & Domains10
Sequences
Length
317
Mass
35,001
Sequence
MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIIVAVVIATAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P12318-1; Sequence=Displayed; Name=2; IsoId=P12318-2; Sequence=VSP_036865
Alternative Sequence
35; Missing (in isoform 2)
3D Structural Models
Helix
96..98; 146..148; 179..181
Beta Strand
42..47; 50..53; 57..64; 68..71; 73..77; 80..82; 87..93; 100..106; 107..110; 115..120; 123..127; 131..133; 139..145; 151..158; 161..168; 171..176; 183..191; 194..197; 201..205
3D Structure
X-ray crystallography (7)
Domain & Motif Annotations
Domain (FT)
39..118; Ig-like C2-type 1; 122..204; Ig-like C2-type 2
Region
292..317; Disordered
Clinical Relevance6
Disease Involvement
FDA approved drug targets
Related Diseases (3)
Biomarker
Preclinical; Phase 2; Approved (orphan drug)
Drug Targets
FDA approved drug targets
Drugs (6)
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 30950185 | Unique Protein Profiles of Extracellular Vesicles as Diagnostic Biomarkers for Early and Advanced Non-Small Cell Lung Cancer. | No abstract available |