Protein detail
ACTN1
Alpha-actinin-1 (Alpha-actinin cytoskeletal isoform) (F-actin cross-linking protein) (Non-muscle alpha-actinin-1)
Entry name ACTN1 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Disease related genesFDA approved drug targetsHuman disease related genesPlasma proteinsPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information10
Protein Names
Alpha-actinin-1 (Alpha-actinin cytoskeletal isoform) (F-actin cross-linking protein) (Non-muscle alpha-actinin-1)
Protein Class (5)
Disease related genesFDA approved drug targetsHuman disease related genesPlasma proteinsPredicted intracellular proteins
Protein Function (4)
- Disease related genes
- Human disease related genes:Cardiovascular diseases:Hematologic diseases
- Predicted intracellular proteins
- FDA approved drug targets:Biotech drugs
Ensembl
Entrez Gene Symbol
Gene Description
Actinin alpha 1
Chromosome
14
Position
68874128-68979440
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization1
Function & Pathway7
Protein Function (4)
- Disease related genes
- Human disease related genes:Cardiovascular diseases:Hematologic diseases
- Predicted intracellular proteins
- FDA approved drug targets:Biotech drugs
Cellular Component (20)
- GO:0001725 stress fiber
- GO:0001726 ruffle
- GO:0005576 extracellular region
- GO:0005615 extracellular space
- GO:0005737 cytoplasm
- GO:0005829 cytosol
- GO:0005884 actin filament
- GO:0005886 plasma membrane
- GO:0005903 brush border
- GO:0005911 cell-cell junction
Page 1 of 2
Molecular Function (10)
- GO:0003725 double-stranded RNA binding
- GO:0005178 integrin binding
- GO:0005509 calcium ion binding
- GO:0005515 protein binding
- GO:0017166 vinculin binding
- GO:0030374 nuclear receptor coactivator activity
- GO:0042803 protein homodimerization activity
- GO:0044325 transmembrane transporter binding
- GO:0051015 actin filament binding
- GO:0099186 structural constituent of postsynapse
Biological Process (3)
KEGG (12)
- hsa04510 Focal adhesion
- KEGG:hsa04517 IgSF CAM signaling
- KEGG:hsa04518 Integrin signaling
- KEGG:hsa04519 Cadherin signaling
- KEGG:hsa04520 Adherens junction
- KEGG:hsa04530 Tight junction
- KEGG:hsa04670 Leukocyte transendothelial migration
- KEGG:hsa04810 Regulation of actin cytoskeleton
- KEGG:hsa05131 Shigellosis
- KEGG:hsa05146 Amoebiasis
Page 1 of 2
Reactome (17)
- R-hsa-1500931 cell cell communication
- R-hsa-446353 cell extracellular matrix interactions
- R-hsa-446728 cell junction organization
- R-hsa-1474244 extracellular matrix organization
- R-hsa-109582 hemostasis
- R-hsa-373753 nephrin family interactions
- R-hsa-3000171 non integrin membrane ecm interactions
- R-hsa-76002 platelet activation signaling and aggregation
- R-hsa-446388 regulation of cytoskeletal remodeling and cell spreading by ipp complex components
- R-hsa-76005 response to elevated platelet cytosolic ca2
Page 1 of 2
Mediation Categories (5)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence39
Enzyme-Mediated Modification (7)
7 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| ACTN1 | PTK2 | Q05397 | Y | 12 | phosphorylation | PhosphoNetworksSparser_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperdbPTMKEAphosphoELMSIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:19229129ProtMapper:25860875KEA:11369769dbPTM:11369769SIGNOR:23454549SIGNOR:11369769ProtMapper:11369769phosphoELM:11369769KEA:16291744ProtMapper:23454549ProtMapper:20159040 |
| ACTN1 | PTK2 | Q05397 | Y | 193 | phosphorylation | PhosphoNetworks | |
| ACTN1 | PTPN1 | P18031 | Y | 12 | dephosphorylation | HPRDSIGNORDEPOD | SIGNOR:16291744DEPOD:16291744HPRD:16291744 |
| ACTN1 | PTPN1 | P18031 | Y | 12 | phosphorylation | SIGNOR_ProtMapperProtMapper | ProtMapper:16291744 |
| ACTN1 | INSR | P06213 | Y | 12 | phosphorylation | KEA | KEA:17570479 |
| ACTN1 | PRKCB | P05771 | T | 50 | phosphorylation | KEA | KEA:17570479 |
| ACTN1 | PRKDC | P78527 | T | 50 | phosphorylation | KEA | KEA:17570479 |
Ligand-Receptor Signaling (13)
13 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ecm | ecm | MatrixDB | Yes | No | No | No | No |
| ecm | ecm | GO_Intercell | Yes | No | No | No | No |
| ecm | ecm | OmniPath | Yes | No | No | No | No |
| extracellular | extracellular | OmniPath | No | No | No | No | No |
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| actin_regulation_adhesome | intracellular_intercellular_related | Adhesome | Yes | No | No | No | No |
Page 1 of 2Next
Regulatory Interaction Network (6)
6 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| PTN1 | P18031 | ACTN1 | P12814 | Yes | Yes | Yes | WangAdhesomeSIGNORProtMapperDEPODHPRDSIGNOR_ProtMapperHPRD-phosSPIKE_LC | SIGNOR:16291744HPRD-phos:16291744SPIKE_LC:17145710DEPOD:16291744Adhesome:16291744ProtMapper:16291744HPRD:16291744 |
| SHAN1 | Q9Y566 | ACTN1 | P12814 | Yes | Yes | No | SIGNOR | SIGNOR:28179641 |
| ACTN1 | P12814 | FAK1 | Q05397 | Yes | Yes | Yes | AdhesomeSIGNORProtMapperHPRDWangREACH_ProtMapper | SIGNOR:16291744Adhesome:11369769ProtMapper:17936423HPRD:11369769 |
| FAK1 | Q05397 | ACTN1 | P12814 | Yes | Yes | Yes | HPRD_MIMPSIGNORProtMapperdbPTMPhosphoSite_KEAphosphoELM_KEAPhosphoNetworksHPRDWangPhosphoSite_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetPhosphoPointKEAHPRD_KEAphosphoELMSIGNOR_ProtMapperREACH_ProtMapperPhosphoSiteSparser_ProtMapperAdhesome | PhosphoSite:23454549SIGNOR:23454549Adhesome:11369769ProtMapper:34099805ProtMapper:16291744ProtMapper:25860875ProtMapper:11369769phosphoELM:11369769ProtMapper:19229129KEA:11369769SIGNOR:11369769KEA:16291744ProtMapper:29642469PhosphoSite:20940419dbPTM:11369769PhosphoSite:11369769ProtMapper:23454549ProtMapper:20159040HPRD:11369769 |
| SHAN3 | Q9BYB0 | ACTN1 | P12814 | Yes | Yes | No | SIGNOR | SIGNOR:28179641 |
| SHAN2 | Q9UPX8 | ACTN1 | P12814 | Yes | Yes | No | SIGNOR | SIGNOR:28179641 |
Protein Complex Composition (12)
12 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| ACTN1ACTN4MYH6MYH7BTPM1TPM2TPM3TPM4 | A7E2Y1O43707P06753P07951P09493P12814P13533P67936 | 0:0:0:0:0:0:0:0 | hu.MAP2 | |||
| ACTN1ACTN4CALM1CLIC1PDIA4TPM2 | O00299O43707P07951P0DP23P12814P13667 | 0:0:0:0:0:0 | hu.MAP | |||
| ACTN1ACTN4CALM2CLIC1PDIA4TPM2 | O00299O43707P07951P0DP24P12814P13667 | 0:0:0:0:0:0 | hu.MAP | |||
| ACTN1ACTN4CALM3CLIC1PDIA4TPM2 | O00299O43707P07951P0DP25P12814P13667 | 0:0:0:0:0:0 | hu.MAP | |||
| ACTN1DDX20GEMIN2RAC1SMN1SNRNP70SNRPASNRPA1SNRPCSNRPD2SNRPESNRPFSNRPG | O14893P08621P09012P09234P09661P12814P62304P62306P62308P62316P63000Q16637Q9UHI6 | 1:1:1:1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC7144 | ||
| ACTN1ACTN4CALM1PDIA4 | O43707P0DP23P12814P13667 | 0:0:0:0 | hu.MAP | |||
| ACTN1ACTN4CALM2PDIA4 | O43707P0DP24P12814P13667 | 0:0:0:0 | hu.MAP | |||
| ACTN1ACTN4CALM3PDIA4 | O43707P0DP25P12814P13667 | 0:0:0:0 | hu.MAP | |||
| ACTN1VCL | P12814P18206 | 0:0 | KEGG-MEDICUS | |||
| ACTN1TLN1VCL | P12814P18206Q9Y490 | 0:0:0 | KEGG-MEDICUS |
Page 1 of 2Next
Sequence, Structure & Domains14
Sequences
Length
892
Mass
103,058
Sequence
MDHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNAWGCLEQVEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIEMHGTLEDQLSHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGYDIGNDPQGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDKNYITMDELRRELPPDQAEYCIARMAPYTGPDSVPGALDYMSFSTALYGESDL
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=P12814-1; Sequence=Displayed; Name=2; IsoId=P12814-2; Sequence=VSP_041264; Name=3; IsoId=P12814-3; Sequence=VSP_043525; Name=4; IsoId=P12814-4; Sequence=VSP_041264, VSP_047763
Alternative Sequence
761..787; DHSGTLGPEEFKACLISLGYDIGNDPQ -> KKTGMMDTDDFRACLISMGYNM (in isoform 2 and isoform 4); 787; Q -> QKKTGMMDTDDFRACLISMGYNM (in isoform 3); 840; K -> KLQEGGKMQTAHAAFTPPGFAAVSGRAALRLLDFAAFLTTLSSQ (in isoform 4)
3D Structural Models
Turn
55..61; 136..138; 884..888
Helix
30..45; 46..48; 63..73; 86..102; 112..116; 120..135; 146..158; 171..173; 177..186; 188..190; 193..195; 201..215; 224..229; 235..249; 745..751; 754..757; 768..774; 775..778; 788..798; 809..816; 818..820; 826..830; 832..837; 845..851; 855..863
Beta Strand
168..170; 230..232; 763..766; 803..807; 841..844; 864..867; 869..872; 876..881
3D Structure
NMR spectroscopy (2); X-ray crystallography (2)
Domain & Motif Annotations
Repeat
274..384; Spectrin 1; 394..499; Spectrin 2; 509..620; Spectrin 3; 630..733; Spectrin 4
Domain (FT)
31..135; Calponin-homology (CH) 1; 144..250; Calponin-homology (CH) 2; 746..781; EF-hand 1; 787..822; EF-hand 2
Region
1..247; Actin-binding; 274..733; Interaction with DDN
Protein Families
Alpha-actinin family
Sequence Similarities
Belongs to the alpha-actinin family.
Clinical Relevance7
Disease Involvement (2)
Disease variantFDA approved drug targets
Drug Targets
FDA approved drug targets
Drugs (2)
Interaction Protein (8)
ENSG00000004848ENSG00000077522ENSG00000100038ENSG00000130402ENSG00000151067ENSG00000171992ENSG00000179933ENSG00000248746
Interaction Count
8
Interaction Dataset (3)
intact_biogridintact_biogrid_opencellbiogrid_opencell
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 32384937 | Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles. | No abstract available |