Protein detail
NCAM1
Neural cell adhesion molecule 1 (N-CAM-1) (NCAM-1) (CD antigen CD56)
Entry name NCAM1 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification Cancer-related genesCD markersPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsPredicted secreted proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Neural cell adhesion molecule 1 (N-CAM-1) (NCAM-1) (CD antigen CD56)
Protein Class (7)
Cancer-related genesCD markersPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsPredicted secreted proteinsTransporters
Protein Function (5)
- Predicted intracellular proteins
- CD markers
- Cancer-related genes:Candidate cancer biomarkers
- Predicted secreted proteins
- Transporters:Accessory Factors Involved in Transport
Transmembrane
719..739; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
CD56NCAM
Gene Description
Neural cell adhesion molecule 1
Chromosome
11
Position
112961247-113278436
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization1
Function & Pathway8
Protein Function (5)
- Predicted intracellular proteins
- CD markers
- Cancer-related genes:Candidate cancer biomarkers
- Predicted secreted proteins
- Transporters:Accessory Factors Involved in Transport
Cellular Component (8)
Molecular Function (2)
Biological Process (3)
KEGG (4)
Reactome (12)
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-3000178 ecm proteoglycans
- R-hsa-1474244 extracellular matrix organization
- R-hsa-877300 interferon gamma signaling
- R-hsa-913531 interferon signaling
- R-hsa-373760 l1cam interactions
- R-hsa-5684996 mapk1 mapk3 signaling
- R-hsa-5683057 mapk family signaling cascades
- R-hsa-419037 ncam1 interactions
- R-hsa-375165 ncam signaling for neurite out growth
Page 1 of 2
Canonical Pathways (3)
- M277 Pid integrin a4b1 pathway
- M241 Pid rac1 reg pathway
- M156 Pid ecadherin nascent aj pathway
Mediation Categories (4)
Clinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence53
Enzyme-Mediated Modification (3)
3 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| NCAM1 | ST8SIA4 | Q92187 | N | 449 | glycosylation | HPRD | HPRD:17623646HPRD:9774483 |
| NCAM1 | ST8SIA4 | Q92187 | N | 459 | glycosylation | HPRD | HPRD:17623646HPRD:9774483 |
| NCAM1 | MAPK1 | P28482 | T | 803 | phosphorylation | PhosphoSite |
Ligand-Receptor Signaling (46)
46 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | UniProt_topology | No | No | Yes | Yes | Yes |
| transmembrane | transmembrane | UniProt_keyword | No | No | Yes | Yes | Yes |
| transmembrane_predicted | transmembrane | OmniPath | No | No | Yes | Yes | Yes |
| transmembrane | transmembrane | CellPhoneDB | No | No | Yes | Yes | Yes |
| transmembrane | transmembrane | TopDB | No | No | Yes | Yes | Yes |
| transmembrane | transmembrane | Ramilowski_location | No | No | Yes | Yes | Yes |
| transmembrane | transmembrane | OmniPath | No | No | Yes | Yes | Yes |
| peripheral | peripheral | UniProt_location | No | No | Yes | Yes | Yes |
| peripheral | peripheral | OmniPath | No | No | Yes | Yes | Yes |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | Yes | Yes | Yes |
Regulatory Interaction Network (2)
2 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| GDNF | P39905 | NCAM1 | P13591 | Yes | Yes | No | HPRDSIGNOR | HPRD:12837245SIGNOR:15212950 |
| MK01 | P28482 | NCAM1 | P13591 | Yes | No | No | PhosphoSite | PhosphoSite:28193531 |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Size Exclusion Chromatography | Mass spectrometry | 1 | 28211531 |
Sequence, Structure & Domains11
Sequences
Length
858
Mass
94,574
Sequence
MLQTKDLIWTLFFLGTAVSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAENKAGEQDATIHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPEKQETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPDSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFKTQPVQGEPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIPANGSPTSGLSTGAIVGILIVIFVLLLVVVDITCYFLNKCGLFMCIAVNLCGKAGPGAKGKDMEEGKAAFSKDESKEPIVEVRTEEERTPNHDGGKHTEPNETTPLTEPEKGPVEAKPECQETETKPAPAEVKTVPNDATQTKENESKA
Alternative Products
Event=Alternative splicing; Named isoforms=6; Name=1; IsoId=P13591-2; Sequence=Displayed; Name=2; Synonyms=N-CAM 140; IsoId=P13591-1; Sequence=VSP_034818; Name=3; Synonyms=N-CAM 120; IsoId=P13591-3, P13592-2; Sequence=VSP_034818, VSP_034822, VSP_034824, VSP_034825; Name=4; IsoId=P13591-4; Sequence=VSP_034818, VSP_034824, VSP_034825; Name=5; Synonyms=C; IsoId=P13591-5, P13592-1; Sequence=VSP_034821, VSP_034823; Name=6; IsoId=P13591-6; Sequence=VSP_034819, VSP_034820
Alternative Sequence
354..363; Missing (in isoform 2, isoform 3 and isoform 4); 364; T -> V (in isoform 6); 365..858; Missing (in isoform 6); 609..665; QGEPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSG -> HSPPPPASASSSTPVPLSPPDTTWPLPALATTEPAKNIAQNHCCNMFQAGLHNALMK (in isoform 5); 609; Q -> HSPPPPASASSSTPVPLSPPDTTWPLPALATTEPAK (in isoform 3); 666..858; Missing (in isoform 5); 712..736; NGSPTSGLSTGAIVGILIVIFVLLL -> TLGGNSASYTFVSLLFSAVTLLLLC (in isoform 3 and isoform 4); 737..858; Missing (in isoform 3 and isoform 4)
3D Structural Models
Helix
88..90; 481..483; 562..568
Beta Strand
21..32; 37..45; 51..55; 69..75; 78..83; 92..99; 105..115; 414..419; 422..426; 432..442; 445..450; 453..456; 458..460; 462..468; 471..476; 485..492; 497..506; 514..520; 525..530; 542..549; 556..561; 569..573; 581..590; 601..604; 616..621; 628..633; 638..640; 644..651; 660..662; 668..671; 676..678; 679..688; 696..701
3D Structure
NMR spectroscopy (1); X-ray crystallography (6)
Domain & Motif Annotations
Compositional Bias
768..809; Basic and acidic residues; 817..834; Basic and acidic residues
Domain (FT)
20..111; Ig-like C2-type 1; 116..205; Ig-like C2-type 2; 212..301; Ig-like C2-type 3; 308..413; Ig-like C2-type 4; 416..501; Ig-like C2-type 5; 509..608; Fibronectin type-III 1; 611..706; Fibronectin type-III 2
Region
766..858; Disordered
Clinical Relevance6
Disease Involvement
Cancer-related genes
Related Diseases (3)
Biomarker
Phase 1/2; Phase 1
Drug Targets
Clinical trial target
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 24196483 | Subfractionation, characterization, and in-depth proteomic analysis of glomerular membrane vesicles in human urine. | No abstract available |