Protein detail
CEAM1
Cell adhesion molecule CEACAM1 (Biliary glycoprotein 1) (BGP-1) (Carcinoembryonic antigen-related cell adhesion molecule 1) (CEA cell adhesion molecule 1) (CD antigen CD66a)
Entry name CEAM1 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification CD markersPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Cell adhesion molecule CEACAM1 (Biliary glycoprotein 1) (BGP-1) (Carcinoembryonic antigen-related cell adhesion molecule 1) (CEA cell adhesion molecule 1) (CD antigen CD66a)
Protein Class (4)
CD markersPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins
Protein Function (2)
- CD markers
- Predicted intracellular proteins
Transmembrane
429..452; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
BGPBGP1CD66a
Gene Description
CEA cell adhesion molecule 1
Chromosome
19
Position
42507304-42561234
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Cell SpecificPlasma cellsSingle-Nuclei Brain SpecificleukocyteBlood Cell SpecificT-regBlood Lineage SpecificT-cells
Function & Pathway
Protein Function (2)
- CD markers
- Predicted intracellular proteins
Cellular Component (15)
- GO:0005886 plasma membrane
- GO:0005911 cell-cell junction
- GO:0005912 adherens junction
- GO:0009925 basal plasma membrane
- GO:0009986 cell surface
- GO:0016020 membrane
- GO:0016324 apical plasma membrane
- GO:0016328 lateral plasma membrane
- GO:0030054 cell junction
- GO:0030658 transport vesicle membrane
Page 1 of 2
Molecular Function (12)
- GO:0003674 molecular_function
- GO:0003779 actin binding
- GO:0005515 protein binding
- GO:0005516 calmodulin binding
- GO:0015125 bile acid transmembrane transporter activity
- GO:0019900 kinase binding
- GO:0019903 protein phosphatase binding
- GO:0031005 filamin binding
- GO:0042802 identical protein binding
- GO:0042803 protein homodimerization activity
Page 1 of 2
Biological Process (3)
Reactome (8)
- R-hsa-202733 cell surface interactions at the vascular wall
- R-hsa-1474244 extracellular matrix organization
- R-hsa-1566977 fibronectin matrix formation
- R-hsa-109582 hemostasis
- R-hsa-168249 innate immune system
- R-hsa-9856651 mitf m dependent gene expression
- R-hsa-9730414 mitf m regulated melanocyte development
- R-hsa-6798695 neutrophil degranulation
Mediation Categories (5)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence54
Enzyme-Mediated Modification (7)
7 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| CEACAM1 | SRC | P12931 | Y | 493 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapper | KEA:17570479ProtMapper:9867848KEA:9867848SIGNOR:9867848 |
| CEACAM1 | SRC | P12931 | Y | 520 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPProtMapperKEASIGNOR_ProtMapper | KEA:9867848ProtMapper:9867848 |
| CEACAM1 | CAMK2D | Q13557 | T | 457 | phosphorylation | SIGNOR_ProtMapperPhosphoSiteSIGNORProtMapper | ProtMapper:24302721SIGNOR:24302721 |
| CEACAM1 | CAMK2D | Q13557 | S | 459 | phosphorylation | PhosphoSite | |
| CEACAM1 | MAP3K10 | Q02779 | S | 508 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPHPRDKEA | HPRD:11850617KEA:11850617 |
| CEACAM1 | PRKCD | Q05655 | T | 457 | phosphorylation | Sparser_ProtMapperProtMapper | |
| CEACAM1 | LYN | P07948 | Y | 520 | phosphorylation | KEA | KEA:17570479 |
Ligand-Receptor Signaling (43)
43 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | UniProt_location | Yes | Yes | |||
| transmembrane | transmembrane | UniProt_topology | Yes | Yes | |||
| transmembrane | transmembrane | UniProt_keyword | Yes | Yes | |||
| transmembrane | transmembrane | CellPhoneDB | Yes | Yes | |||
| transmembrane | transmembrane | TopDB | Yes | Yes | |||
| transmembrane | transmembrane | LOCATE | Yes | Yes | |||
| transmembrane | transmembrane | OmniPath | Yes | Yes | |||
| plasma_membrane | plasma_membrane | UniProt_location | Yes | Yes | |||
| plasma_membrane | plasma_membrane | Cellinker | Yes | Yes | |||
| basal_cell_membrane | plasma_membrane | UniProt_location | Yes | Yes |
Regulatory Interaction Network (2)
2 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KCC2D | Q13557 | CEAM1 | P13688 | Yes | Yes | PhosphoSite_norefSIGNORiPTMnetProtMapperSIGNOR_ProtMapperPhosphoSite | SIGNOR:24302721PhosphoSite:17546042PhosphoSite:19909740ProtMapper:24302721PhosphoSite:24302721 | |
| SRC | P12931 | CEAM1 | P13688 | Yes | Yes | phosphoELM_MIMPAdhesomeMIMPPhosphoSite_MIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperNetworKIN_KEA | KEA:9867848ProtMapper:9867848Adhesome:9867848SIGNOR:9867848KEA:17570479HPRD:9867848 |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometryR Sequencing | 1 | 32297178 |
Sequence, Structure & Domains
Sequences
Length
526
Mass
57,560
Sequence
MGHLSAPLHRVRVPWQGLLLTASLLTFWNPPTTAQLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKGERVDGNRQIVGYAIGTQQATPGPANSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPETQDTTYLWWINNQSLPVSPRLQLSNGNRTLTLLSVTRNDTGPYECEIQNPVSANRSDPVTLNVTYGPDTPTISPSDTYYRPGANLSLSCYAASNPPAQYSWLINGTFQQSTQELFIPNITVNNSGSYTCHANNSVTGCNRTTVKTIIVTELSPVVAKPQIKASKTTVTGDKDSVNLTCSTNDTGISIRWFFKNQSLPSSERMKLSQGNTTLSINPVKREDAGTYWCEVFNPISKNQSDPIMLNVNYNALPQENGLSPGAIAGIVIGVVALVALIAVALACFLHFGKTGRASDQRDLTEHKPSVSNHTQDHSNDPPNKMNEVTYSTLNFEAQQPTQPTSASPSLTATEIIYSEVKKQ
Alternative Products
Event=Alternative splicing; Named isoforms=11; Name=1; Synonyms=BGPa, CEACAM1-4L, TM1-CEA; IsoId=P13688-1; Sequence=Displayed; Name=2; Synonyms=BGPg, CEACAM1-4C1; IsoId=P13688-2; Sequence=VSP_002482, VSP_002483; Name=3; Synonyms=BGPh, CEACAM1-3; IsoId=P13688-3; Sequence=VSP_002478, VSP_002479; Name=4; Synonyms=BGPi, CEACAM1-3C2; IsoId=P13688-4; Sequence=VSP_002480, VSP_002481; Name=5; Synonyms=BGPy, CEACAM1-3AL; IsoId=P13688-5; Sequence=VSP_009227; Name=6; Synonyms=BGPb, CEACAM1-3L, TM2-CEA; IsoId=P13688-6; Sequence=VSP_010938; Name=7; Synonyms=BGPx, CEACAM1-1L; IsoId=P13688-7; Sequence=VSP_012222; Name=8; Synonyms=BGPc, CEACAM1-4S, TM3-CEA; IsoId=P13688-8; Sequence=VSP_040572, VSP_040574; Name=9; Synonyms=BGPz, CEACAM1-3AS; IsoId=P13688-9; Sequence=VSP_040571, VSP_040572, VSP_040574; Name=10; IsoId=P13688-10; Sequence=VSP_040573, VSP_040575; Name=11; Synonyms=BGPd, CEACAM1-3S; IsoId=P13688-11; Sequence=VSP_010938, VSP_040572, VSP_040574
Alternative Sequence
143..416; Missing (in isoform 7); 320..416; ELSPVVAKPQIKASKTTVTGDKDSVNLTCSTNDTGISIRWFFKNQSLPSSERMKLSQGNTTLSINPVKREDAGTYWCEVFNPISKNQSDPIMLNVNY -> D (in isoform 6 and isoform 11); 320..321; EL -> GK (in isoform 3); 321..416; LSPVVAKPQIKASKTTVTGDKDSVNLTCSTNDTGISIRWFFKNQSLPSSERMKLSQGNTTLSINPVKREDAGTYWCEVFNPISKNQSDPIMLNVNY -> RQNLTMLPRLDSNSWAQAILPSVSQSAEITD (in isoform 5); 321..416; LSPVVAKPQIKASKTTVTGDKDSVNLTCSTNDTGISIRWFFKNQSLPSSERMKLSQGNTTLSINPVKREDAGTYWCEVFNPISKNQSDPIMLNVNY -> MAFHHVAKAGLKLLSSSNPPASTSQSAKITD (in isoform 9); 321..351; LSPVVAKPQIKASKTTVTGDKDSVNLTCSTN -> SPVLGEDEAVPGQHHPQHKPCQEGGCWDVLV (in isoform 4); 322..526; Missing (in isoform 3); 352..526; Missing (in isoform 4); 416..417; YN -> CK (in isoform 2); 418..526; Missing (in isoform 2); 459..464; RASDQR -> SSGPLQ (in isoform 8, isoform 9 and isoform 11); 460..468; ASDQRDLTE -> TTPMTHLTR (in isoform 10); 465..526; Missing (in isoform 8, isoform 9 and isoform 11); 469..526; Missing (in isoform 10)
3D Structural Models
Turn
84..87
Helix
75..77; 114..116
Beta Strand
37..45; 51..57; 60..72; 78..83; 88..91; 99..101; 107..109; 118..126; 132..140
3D Structure
Electron microscopy (2); X-ray crystallography (15)
Domain & Motif Annotations
Compositional Bias
461..482; Basic and acidic residues; 489..513; Polar residues
Domain (CC)
Ig-like V-type domain mediates trans-homophilic cell adhesion through homodimerization and this active process is regulated by tyrosine kinase, PTPN11 and PTPN6. Ig-like C2-type and/or cytoplasmic domains mediate cis-dimer/oligomer.
Domain (FT)
35..142; Ig-like V-type; 145..232; Ig-like C2-type 1; 237..317; Ig-like C2-type 2; 323..413; Ig-like C2-type 3
Region
39..142; Required for homophilic binding; 450..462; Interaction with calmodulin; 452..526; Interaction with FLNA; 461..513; Disordered; 489..526; Required for interaction with PTPN11 and PTPN6 and for control of phosphorylation level; 520..523; Essential for interaction with PTPN11 and PTPN6
Protein Families (2)
- Immunoglobulin superfamily
- CEA family
Sequence Similarities
Belongs to the immunoglobulin superfamily. CEA family.
Clinical Relevance
Related Diseases
Biomarker
Phase 1/2
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 27863537 | High-resolution proteomic and lipidomic analysis of exosomes and microvesicles from different cell sources. | No related sentences available |