Protein detail
HLAE
HLA class I histocompatibility antigen, alpha chain E (MHC class I antigen E) [Cleaved into: Soluble HLA class I histocompatibility antigen, alpha chain E (sHLA-E)]
Protein symbol HLAE | UniProt ID | EVMP score 0.50 |
Frequency 9 | Transmembrane count 1 | Protein classification Plasma proteinsPredicted membrane proteinsPredicted secreted proteins |
Basic Information
Protein Names
HLA class I histocompatibility antigen, alpha chain E (MHC class I antigen E) [Cleaved into: Soluble HLA class I histocompatibility antigen, alpha chain E (sHLA-E)]
Protein Class
Plasma proteinsPredicted membrane proteinsPredicted secreted proteins
Protein Function
Predicted secreted proteins
Transmembrane
306..329; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Description
Major histocompatibility complex, class I, E
Chromosome
6
Position
30489509-30494194
Frequency
9
EVMP Score
0.50
Fluorescence & Localization
Cell SpecificColonocytes
Function & Pathway
Protein Function
Predicted secreted proteins
Cellular Component
- GO:0000139 Golgi membrane
- GO:0005615 extracellular space
- GO:0005886 plasma membrane
- GO:0009897 external side of plasma membrane
- GO:0009986 cell surface
- GO:0012507 ER to Golgi transport vesicle membrane
- GO:0030670 phagocytic vesicle membrane
- GO:0031901 early endosome membrane
- GO:0032398 MHC class Ib protein complex
- GO:0042612 MHC class I protein complex
- GO:0055038 recycling endosome membrane
- GO:0070062 extracellular exosome
- GO:0098553 lumenal side of endoplasmic reticulum membrane
Molecular Function
Biological Process
KEGG
- hsa04144 Endocytosis
- KEGG:hsa04145 Phagosome
- KEGG:hsa04218 Cellular senescence
- KEGG:hsa04514 Cell adhesion molecule (CAM) interaction
- KEGG:hsa04612 Antigen processing and presentation
- KEGG:hsa04650 Natural killer cell mediated cytotoxicity
- KEGG:hsa04940 Type I diabetes mellitus
- KEGG:hsa05163 Human cytomegalovirus infection
- KEGG:hsa05165 Human papillomavirus infection
- KEGG:hsa05166 Human T-cell leukemia virus 1 infection
- KEGG:hsa05167 Kaposi sarcoma-associated herpesvirus infection
- KEGG:hsa05168 Herpes simplex virus 1 infection
- KEGG:hsa05169 Epstein-Barr virus infection
- KEGG:hsa05170 Human immunodeficiency virus 1 infection
- KEGG:hsa05203 Viral carcinogenesis
- KEGG:hsa05320 Autoimmune thyroid disease
- KEGG:hsa05330 Allograft rejection
- KEGG:hsa05332 Graft-versus-host disease
- KEGG:hsa05416 Viral myocarditis
Reactome
- R-hsa-1280218 adaptive immune system
- R-hsa-983170 antigen presentation folding assembly and peptide loading of class i mhc
- R-hsa-1236975 antigen processing cross presentation
- R-hsa-983169 class i mhc mediated antigen processing presentation
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-2172127 dap12 interactions
- R-hsa-2424491 dap12 signaling
- R-hsa-1236977 endosomal vacuolar pathway
- R-hsa-198933 immunoregulatory interactions between a lymphoid and a non lymphoid cell
- R-hsa-5663205 infectious disease
- R-hsa-168249 innate immune system
- R-hsa-909733 interferon alpha beta signaling
- R-hsa-877300 interferon gamma signaling
- R-hsa-913531 interferon signaling
- R-hsa-9705671 sars cov 2 activates modulates innate and adaptive immune responses
- R-hsa-9705683 sars cov 2 host interactions
- R-hsa-9694516 sars cov 2 infection
- R-hsa-9679506 sars cov infections
- R-hsa-9824446 viral infection pathways
Mediation Categories
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
48 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | GO_Intercell | No | Yes | Yes | Yes | No |
| receptor | receptor | Baccin2019 | No | Yes | Yes | Yes | No |
| receptor | receptor | OmniPath | No | Yes | Yes | Yes | No |
| extracellular | extracellular | DGIdb | No | No | Yes | Yes | No |
| extracellular | extracellular | OmniPath | No | No | Yes | Yes | No |
| intracellular | intracellular | ComPPI | No | No | Yes | Yes | No |
| intracellular | intracellular | GO_Intercell | No | No | Yes | Yes | No |
| intracellular | intracellular | UniProt_location | No | No | Yes | Yes | No |
| intracellular | intracellular | OmniPath | No | No | Yes | Yes | No |
| cell_surface_ligand | cell_surface_ligand | connectomeDB2020 | Yes | No | Yes | Yes | No |
Page 1 of 5Next
Regulatory Interaction Network
0 records.
Protein Complex Composition
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 23161513 |
Sequence, Structure & Domains
Sequences
Length
358
Mass
40,058
Sequence
MVDGTLLLLLSEALALTQTWAGSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDGRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTIPIVGIIAGLVLLGSVVSGAVVAAVIWRKKSSGGKGGSYSKAEWSDSAQGSESHSL
3D Structural Models
Helix
71..75; 78..105; 159..170; 173..182; 184..195; 197..200; 275..277
Beta Strand
24..33; 38..40; 42..49; 52..58; 61..63; 67..70; 110..112; 115..124; 128..139; 142..147; 154..156; 207..214; 216..232; 235..240; 243..245; 248..251; 258..260; 262..271; 278..283; 287..289; 291..293
3D Structure
X-ray crystallography (30)
Domain & Motif Annotations
Compositional Bias
348..358; Polar residues
Domain (FT)
206..294; Ig-like C1-type
Region
22..111; Alpha-1; 112..203; Alpha-2; 204..295; Alpha-3; 296..305; Connecting peptide; 333..358; Disordered
Protein Families
MHC class I family
Sequence Similarities
Belongs to the MHC class I family.