Protein detail
HLAE
HLA class I histocompatibility antigen, alpha chain E (MHC class I antigen E) [Cleaved into: Soluble HLA class I histocompatibility antigen, alpha chain E (sHLA-E)]
Entry name HLAE | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 9 | Transmembrane count 1 | Protein classification Plasma proteinsPredicted membrane proteinsPredicted secreted proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information12
Protein Names
HLA class I histocompatibility antigen, alpha chain E (MHC class I antigen E) [Cleaved into: Soluble HLA class I histocompatibility antigen, alpha chain E (sHLA-E)]
Protein Class (3)
Plasma proteinsPredicted membrane proteinsPredicted secreted proteins
Protein Function
Predicted secreted proteins
Transmembrane
306..329; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Description
Major histocompatibility complex, class I, E
Chromosome
6
Position
30489509-30494194
Supporting publications (n)
9
EVMP confidence score
0.50
Fluorescence & Localization1
Cell SpecificColonocytes
Function & Pathway7
Protein Function
Predicted secreted proteins
Cellular Component (13)
- GO:0000139 Golgi membrane
- GO:0005615 extracellular space
- GO:0005886 plasma membrane
- GO:0009897 external side of plasma membrane
- GO:0009986 cell surface
- GO:0012507 ER to Golgi transport vesicle membrane
- GO:0030670 phagocytic vesicle membrane
- GO:0031901 early endosome membrane
- GO:0032398 MHC class Ib protein complex
- GO:0042612 MHC class I protein complex
Page 1 of 2
Molecular Function (7)
Biological Process (3)
KEGG (19)
- hsa04144 Endocytosis
- KEGG:hsa04145 Phagosome
- KEGG:hsa04218 Cellular senescence
- KEGG:hsa04514 Cell adhesion molecule (CAM) interaction
- KEGG:hsa04612 Antigen processing and presentation
- KEGG:hsa04650 Natural killer cell mediated cytotoxicity
- KEGG:hsa04940 Type I diabetes mellitus
- KEGG:hsa05163 Human cytomegalovirus infection
- KEGG:hsa05165 Human papillomavirus infection
- KEGG:hsa05166 Human T-cell leukemia virus 1 infection
Page 1 of 2
Reactome (19)
- R-hsa-1280218 adaptive immune system
- R-hsa-983170 antigen presentation folding assembly and peptide loading of class i mhc
- R-hsa-1236975 antigen processing cross presentation
- R-hsa-983169 class i mhc mediated antigen processing presentation
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-2172127 dap12 interactions
- R-hsa-2424491 dap12 signaling
- R-hsa-1236977 endosomal vacuolar pathway
- R-hsa-198933 immunoregulatory interactions between a lymphoid and a non lymphoid cell
- R-hsa-5663205 infectious disease
Page 1 of 2
Mediation Categories (4)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence52
Ligand-Receptor Signaling (48)
48 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | CellPhoneDB | No | No | Yes | Yes | No |
| transmembrane | transmembrane | TopDB | No | No | Yes | Yes | No |
| transmembrane | transmembrane | LOCATE | No | No | Yes | Yes | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | Yes | Yes | No |
| transmembrane | transmembrane | OmniPath | No | No | Yes | Yes | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | Yes | Yes | No |
| plasma_membrane | plasma_membrane | Cellinker | No | No | Yes | Yes | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | Yes | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | Membranome | No | No | Yes | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | CSPA | No | No | Yes | Yes | No |
Protein Complex Composition (3)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 23161513 |
Sequence, Structure & Domains11
Sequences
Length
358
Mass
40,058
Sequence
MVDGTLLLLLSEALALTQTWAGSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDGRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTIPIVGIIAGLVLLGSVVSGAVVAAVIWRKKSSGGKGGSYSKAEWSDSAQGSESHSL
3D Structural Models
Helix
71..75; 78..105; 159..170; 173..182; 184..195; 197..200; 275..277
Beta Strand
24..33; 38..40; 42..49; 52..58; 61..63; 67..70; 110..112; 115..124; 128..139; 142..147; 154..156; 207..214; 216..232; 235..240; 243..245; 248..251; 258..260; 262..271; 278..283; 287..289; 291..293
3D Structure
X-ray crystallography (30)
Domain & Motif Annotations
Compositional Bias
348..358; Polar residues
Domain (FT)
206..294; Ig-like C1-type
Region
22..111; Alpha-1; 112..203; Alpha-2; 204..295; Alpha-3; 296..305; Connecting peptide; 333..358; Disordered
Protein Families
MHC class I family
Sequence Similarities
Belongs to the MHC class I family.
Clinical Relevance2
Supporting Publications8
| PMID | Title | Abstract |
|---|---|---|
| 28986585 | Quantitation of putative colorectal cancer biomarker candidates in serum extracellular vesicles by targeted proteomics. | No abstract available |
| 30646616 | Preferential Localization of MUC1 Glycoprotein in Exosomes Secreted by Non-Small Cell Lung Carcinoma Cells. | THBS1, ANXA6, HIST1H4A, COL18A1, MDK, SRGN, ENO1, TUBA4A, SLC3A2, GPI, MIF, MUC1, TALDO1, SLC7A5, ICAM1, HSP90AA1, G6PD, and LRP1 were found to be expressed in exosomes at more than 5-fold higher level as compared to total cellular membrane proteins. |
| 33709510 | Unbiased proteomic profiling of host cell extracellular vesicle composition and dynamics upon HIV-1 infection. | No abstract available |
| 34817906 | Proteomic dissection of large extracellular vesicle surfaceome unravels interactive surface platform. | No abstract available |
| 35611462 | Extracellular vesicles expressing CEACAM proteins in the urine of bladder cancer patients. | No abstract available |
| 37205098 | Proteomic profiling of extracellular vesicles in synovial fluid and plasma from Oligoarticular Juvenile Idiopathic Arthritis patients reveals novel immunopathogenic biomarkers. | No abstract available |
| 37786918 | Rapid and in-depth proteomic profiling of small extracellular vesicles for ultralow samples. | No abstract available |
| 38321535 | Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles. | No abstract available |