Protein detail
ENOB
Beta-enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Enolase 3) (Muscle-specific enolase) (MSE) (Skeletal muscle enolase)
Entry name ENOB | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 2 | Transmembrane count | Protein classification Candidate cardiovascular disease genesDisease related genesEnzymesHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information10
Protein Names
Beta-enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Enolase 3) (Muscle-specific enolase) (MSE) (Skeletal muscle enolase)
Protein Class (8)
Candidate cardiovascular disease genesDisease related genesEnzymesHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteins
Protein Function (7)
- Human disease related genes:Congenital disorders of metabolism:Congenital disorders of carbohydrate metabolism
- Predicted intracellular proteins
- ENZYME proteins:Lyases
- Potential drug targets
- Candidate cardiovascular disease genes
- Enzymes
- Disease related genes
Ensembl
Entrez Gene Symbol
Gene Description
Enolase 3
Chromosome
17
Position
4948092-4957131
Supporting publications (n)
2
EVMP confidence score
0.38
Fluorescence & Localization2
Tissue Specificheart muscleCell SpecificCardiomyocytes
Function & Pathway7
Protein Function (7)
- Human disease related genes:Congenital disorders of metabolism:Congenital disorders of carbohydrate metabolism
- Predicted intracellular proteins
- ENZYME proteins:Lyases
- Potential drug targets
- Candidate cardiovascular disease genes
- Enzymes
- Disease related genes
Cellular Component (6)
Molecular Function (3)
Biological Process (3)
KEGG (7)
Reactome (3)
Mediation Categories
Metabolism mediation
Relations & Evidence20
Ligand-Receptor Signaling (9)
9 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ecm | ecm | MatrixDB | Yes | No | No | No | No |
| ecm | ecm | OmniPath | Yes | No | No | No | No |
| extracellular | extracellular | LOCATE | No | No | No | No | No |
| extracellular | extracellular | OmniPath | No | No | No | No | No |
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Protein Complex Composition (10)
10 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| ENO3GPIPGK1PGK2 | P00558P06744P07205P13929 | 0:0:0:0 | hu.MAP | |||
| ENO3PGK1PGK2TSFM | P00558P07205P13929P43897 | 0:0:0:0 | hu.MAP | |||
| ENO3GFUSPGK1PGK2TSFM | P00558P07205P13929P43897Q13630 | 0:0:0:0:0 | hu.MAP | |||
| ENO3GPIGSTO1MPIPARK7PGK2PGM2TKT | P06744P07205P13929P29401P34949P78417Q96G03Q99497 | 0:0:0:0:0:0:0:0 | hu.MAP | |||
| ENO3GPIPDCD6IPPEF1TMEM256 | P06744P13929Q8N2U0Q8WUM4Q9UBV8 | 0:0:0:0:0 | Havugimana2012 | Havugimana2012:C_426 | ||
| ENO3IDH2MTHFD1 | P11586P13929P48735 | 0:0:0 | hu.MAP2 | |||
| ENO3 | P13929 | 2 | PDB | PDB:2xsx | ||
| CALRENO3RCN3 | P13929P27797Q96D15 | 0:0:0 | hu.MAP | |||
| CALRENO3WRAP53 | P13929P27797Q9BUR4 | 0:0:0 | hu.MAP | |||
| AKR1D1ENO3GSTO1 | P13929P51857P78417 | 0:0:0 | hu.MAP2 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Small R sequencing (Illumi HiSeq 2000 (Solexa)Mass spectrometry | 1 | 37886648 |
Sequence, Structure & Domains11
Sequences
Length
434
Mass
46,987
Sequence
MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKGRYLGKGVLKAVENINNTLGPALLQKKLSVVDQEKVDKFMIELDGTENKSKFGANAILGVSLAVCKAGAAEKGVPLYRHIADLAGNPDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMRIGAEVYHHLKGVIKAKYGKDATNVGDEGGFAPNILENNEALELLKTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLGELYKSFIKNYPVVSIEDPFDQDDWATWTSFLSGVNIQIVGDDLTVTNPKRIAQAVEKKACNCLLLKVNQIGSVTESIQACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEALGDKAIFAGRKFRNPKAK
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P13929-1; Sequence=Displayed; Name=2; IsoId=P13929-2; Sequence=VSP_037753; Name=3; IsoId=P13929-3; Sequence=VSP_037752
Alternative Sequence
61..104; GVLKAVENINNTLGPALLQKKLSVVDQEKVDKFMIELDGTENKS -> A (in isoform 3); 150..177; Missing (in isoform 2)
3D Structural Models
Turn
104..106; 237..239; 259..262; 319..323
Helix
57..59; 63..71; 73..79; 87..98; 108..125; 130..138; 156..158; 178..200; 220..234; 248..251; 267..269; 273..286; 301..309; 325..334; 344..347; 350..362; 380..388; 401..417; 418..420; 425..427
Beta Strand
5..12; 18..26; 29..34; 43..45; 150..154; 159..162; 167..171; 241..245; 289..293; 313..318; 338..342; 366..370; 391..394
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Protein Families
Enolase family
Sequence Similarities
Belongs to the enolase family.
Clinical Relevance6
Disease Involvement (2)
Disease variantGlycogen storage disease
Drugs (2)
Interaction Protein
ENSG00000074800
Interaction Count
1
Interaction Dataset
intact_biogrid_opencell
Supporting Publications2
| PMID | Title | Abstract |
|---|---|---|
| 37503071 | A novel machine learning algorithm selects proteome signature to specifically identify cancer exosomes. | Employing datasets of exosome proteins from human cell lines, tissue, plasma, serum and urine samples from a variety of cancers, we identify Clathrin Heavy Chain (CLTC), Ezrin, (EZR), Talin-1 (TLN1), Adenylyl cyclase-associated protein 1 (CAP1) and Moesin (MSN) as highly abundant universal biomarkers for exosomes and define three panels of pan-cancer exosome proteins that distinguish cancer exosomes from other exosomes and aid in classifying cancer subtypes employing random forest models. |
| 38529947 | A novel machine learning algorithm selects proteome signature to specifically identify cancer exosomes. | Employing datasets of exosome proteins from human cell lines, tissue, plasma, serum, and urine samples from a variety of cancers, we identify Clathrin Heavy Chain (CLTC), Ezrin, (EZR), Talin-1 (TLN1), Adenylyl cyclase-associated protein 1 (CAP1), and Moesin (MSN) as highly abundant universal biomarkers for exosomes and define three panels of pan-cancer exosome proteins that distinguish cancer exosomes from other exosomes and aid in classifying cancer subtypes employing random forest models. |