Protein detail
CD59
CD59 glycoprotein (1F5 antigen) (20 kDa homologous restriction factor) (HRF-20) (HRF20) (MAC-inhibitory protein) (MAC-IP) (MEM43 antigen) (Membrane attack complex inhibition factor) (MACIF) (Membrane inhibitor of reactive lysis) (MIRL) (Protectin) (CD antigen CD59)
Protein symbol CD59 | UniProt ID | EVMP score 0.25 |
Frequency 5 | Transmembrane count | Protein classification Cancer-related genesCD markersDisease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins |
Basic Information
Protein Names
CD59 glycoprotein (1F5 antigen) (20 kDa homologous restriction factor) (HRF-20) (HRF20) (MAC-inhibitory protein) (MAC-IP) (MEM43 antigen) (Membrane attack complex inhibition factor) (MACIF) (Membrane inhibitor of reactive lysis) (MIRL) (Protectin) (CD antigen CD59)
Protein Class
Cancer-related genesCD markersDisease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins
Protein Function
- Predicted intracellular proteins
- CD markers
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Cancer-related genes:Candidate cancer biomarkers
- Disease related genes
Ensembl
Entrez Gene Symbol
Gene Synonym
16.3A5EJ16EJ30EL32G344MIC11MIN1MIN2MIN3MSK21p18-20
Gene Description
CD59 molecule (CD59 blood group)
Chromosome
11
Position
33703010-33736479
Frequency
5
EVMP Score
0.25
Fluorescence & Localization
Function & Pathway
Protein Function
- Predicted intracellular proteins
- CD markers
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Cancer-related genes:Candidate cancer biomarkers
- Disease related genes
Cellular Component
- GO:0000139 Golgi membrane
- GO:0005615 extracellular space
- GO:0005789 endoplasmic reticulum membrane
- GO:0005886 plasma membrane
- GO:0005925 focal adhesion
- GO:0009897 external side of plasma membrane
- GO:0009986 cell surface
- GO:0012507 ER to Golgi transport vesicle membrane
- GO:0016020 membrane
- GO:0030133 transport vesicle
- GO:0031982 vesicle
- GO:0033116 endoplasmic reticulum-Golgi intermediate compartment membrane
- GO:0035579 specific granule membrane
- GO:0070062 extracellular exosome
- GO:0070821 tertiary granule membrane
Molecular Function
Biological Process
Reactome
- R-hsa-446203 asparagine n linked glycosylation
- R-hsa-5694530 cargo concentration in the er
- R-hsa-166658 complement cascade
- R-hsa-204005 copii mediated vesicle transport
- R-hsa-6807878 copi mediated anterograde transport
- R-hsa-199977 er to golgi anterograde transport
- R-hsa-168249 innate immune system
- R-hsa-199991 membrane trafficking
- R-hsa-6798695 neutrophil degranulation
- R-hsa-597592 post translational protein modification
- R-hsa-948021 transport to the golgi and subsequent modification
- R-hsa-5653656 vesicle mediated transport
Canonical Pathways
- M238 Pid thrombin par1 pathway
- M68 Pid rhoa reg pathway
- M99 Pid txa2pathway
Mediation Categories
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
34 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ly6_plur | secreted_receptor | OmniPath | Yes | No | Yes | No | Yes |
| secreted_receptor | secreted_receptor | OmniPath | Yes | No | Yes | No | Yes |
| receptor_regulator | receptor_regulator | OmniPath | Yes | No | Yes | No | Yes |
| transmembrane | transmembrane | TopDB | No | No | Yes | No | Yes |
| transmembrane | transmembrane | OmniPath | No | No | Yes | No | Yes |
| peripheral | peripheral | UniProt_location | No | No | Yes | No | Yes |
| peripheral | peripheral | OmniPath | No | No | Yes | No | Yes |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | Yes | No | Yes |
| plasma_membrane | plasma_membrane | OmniPath | No | No | Yes | No | Yes |
| plasma_membrane_peripheral | plasma_membrane_peripheral | CSPA | No | No | Yes | No | Yes |
Regulatory Interaction Network
0 records.
Protein Complex Composition
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 38014595 |
Sequence, Structure & Domains
Sequences
Length
128
Mass
14,177
Sequence
MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P13987-1; Sequence=Displayed; Name=2; IsoId=P13987-2; Sequence=VSP_060064
Alternative Sequence
103..128; GGTSLSEKTVLLLVTPFLAAAWSLHP -> DTFLKALKDEKLQGLKTKQPGKKSASLS (in isoform 2)
3D Structural Models
Helix
67..69; 72..79; 97..99
Beta Strand
27..29; 32..34; 41..43; 50..56; 59..65; 85..89; 91..93
3D Structure
Electron microscopy (4); NMR spectroscopy (5); X-ray crystallography (8)
Domain & Motif Annotations
Domain (FT)
26..108; UPAR/Ly6
Clinical Relevance
Disease Involvement
Cancer-related genesDisease variantHereditary hemolytic anemia
Related Diseases
Biomarker
Phase 2