Protein detail
CD59
CD59 glycoprotein (1F5 antigen) (20 kDa homologous restriction factor) (HRF-20) (HRF20) (MAC-inhibitory protein) (MAC-IP) (MEM43 antigen) (Membrane attack complex inhibition factor) (MACIF) (Membrane inhibitor of reactive lysis) (MIRL) (Protectin) (CD antigen CD59)
Entry name CD59 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 5 | Transmembrane count | Protein classification Cancer-related genesCD markersDisease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
CD59 glycoprotein (1F5 antigen) (20 kDa homologous restriction factor) (HRF-20) (HRF20) (MAC-inhibitory protein) (MAC-IP) (MEM43 antigen) (Membrane attack complex inhibition factor) (MACIF) (Membrane inhibitor of reactive lysis) (MIRL) (Protectin) (CD antigen CD59)
Protein Class (7)
Cancer-related genesCD markersDisease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins
Protein Function (5)
- Predicted intracellular proteins
- CD markers
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Cancer-related genes:Candidate cancer biomarkers
- Disease related genes
Ensembl
Entrez Gene Symbol
Gene Synonym (11)
16.3A5EJ16EJ30EL32G344MIC11MIN1MIN2MIN3MSK21p18-20
Gene Description
CD59 molecule (CD59 blood group)
Chromosome
11
Position
33703010-33736479
Supporting publications (n)
5
EVMP confidence score
0.53
Function & Pathway
Protein Function (5)
- Predicted intracellular proteins
- CD markers
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Cancer-related genes:Candidate cancer biomarkers
- Disease related genes
Cellular Component (15)
- GO:0000139 Golgi membrane
- GO:0005615 extracellular space
- GO:0005789 endoplasmic reticulum membrane
- GO:0005886 plasma membrane
- GO:0005925 focal adhesion
- GO:0009897 external side of plasma membrane
- GO:0009986 cell surface
- GO:0012507 ER to Golgi transport vesicle membrane
- GO:0016020 membrane
- GO:0030133 transport vesicle
Page 1 of 2
Molecular Function (2)
Biological Process (3)
Reactome (12)
- R-hsa-446203 asparagine n linked glycosylation
- R-hsa-5694530 cargo concentration in the er
- R-hsa-166658 complement cascade
- R-hsa-204005 copii mediated vesicle transport
- R-hsa-6807878 copi mediated anterograde transport
- R-hsa-199977 er to golgi anterograde transport
- R-hsa-168249 innate immune system
- R-hsa-199991 membrane trafficking
- R-hsa-6798695 neutrophil degranulation
- R-hsa-597592 post translational protein modification
Page 1 of 2
Canonical Pathways (3)
- M238 Pid thrombin par1 pathway
- M68 Pid rhoa reg pathway
- M99 Pid txa2pathway
Mediation Categories (4)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence39
Ligand-Receptor Signaling (34)
34 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ly6_plur | secreted_receptor | OmniPath | Yes | Yes | Yes | ||
| secreted_receptor | secreted_receptor | OmniPath | Yes | Yes | Yes | ||
| receptor_regulator | receptor_regulator | OmniPath | Yes | Yes | Yes | ||
| transmembrane | transmembrane | TopDB | Yes | Yes | |||
| transmembrane | transmembrane | OmniPath | Yes | Yes | |||
| peripheral | peripheral | UniProt_location | Yes | Yes | |||
| peripheral | peripheral | OmniPath | Yes | Yes | |||
| plasma_membrane | plasma_membrane | UniProt_location | Yes | Yes | |||
| plasma_membrane | plasma_membrane | OmniPath | Yes | Yes | |||
| plasma_membrane_peripheral | plasma_membrane_peripheral | CSPA | Yes | Yes |
Protein Complex Composition (4)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 38014595 |
Sequence, Structure & Domains
Sequences
Length
128
Mass
14,177
Sequence
MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P13987-1; Sequence=Displayed; Name=2; IsoId=P13987-2; Sequence=VSP_060064
Alternative Sequence
103..128; GGTSLSEKTVLLLVTPFLAAAWSLHP -> DTFLKALKDEKLQGLKTKQPGKKSASLS (in isoform 2)
3D Structural Models
Helix
67..69; 72..79; 97..99
Beta Strand
27..29; 32..34; 41..43; 50..56; 59..65; 85..89; 91..93
3D Structure
Electron microscopy (4); NMR spectroscopy (5); X-ray crystallography (8)
Domain & Motif Annotations
Domain (FT)
26..108; UPAR/Ly6
Clinical Relevance
Disease Involvement (3)
Cancer-related genesDisease variantHereditary hemolytic anemia
Related Diseases (3)
Biomarker
Phase 2
Supporting Publications5
| PMID | Title | Related sentences |
|---|---|---|
| 16708399 | Efficient induction of antitumor T cell immunity by exosomes derived from heat-shocked lymphoma cells. | We found that HS-Exo, compared with control exosomes derived from the same cells (Exo), contain more HSP60 and HSP90 and increased amounts of molecules involved in immunogenicity including MHC class I, MHC class II, CD40, CD86, RANTES and IL-1beta. |
| 35647028 | Dysregulated Exosomes Result in Suppression of the Immune Response of Pregnant COVID-19 Convalescent Women. | In this study, we found several exosomes including CD9, CD31, CD40, CD45, CD41b, CD42a, CD62P, CD69, CD81, CD105, and HLA-DRDPDQ in the plasma of COVID-19-recovered pregnant women were significantly less abundant than the control group. |
| 35655072 | Plasma extracellular vesicles bearing PD-L1, CD40, CD40L or TNF-RII are significantly reduced after treatment of AIDS-NHL. | Emerging evidence shows that tumor cells secrete extracellular vesicles (EVs) that carry bioactive cell surface markers, such as programmed death-ligand 1 (PD-L1), which can modulate immune responses and inhibit anti-tumor responses, potentially playing a role in lymphomagenesis and in promoting the growth of these cancers. |
| 36323431 | Bispecific antibodies targeting CD40 and tumor-associated antigens promote cross-priming of T cells resulting in an antitumor response superior to monospecific antibodies. | TAA-conditional CD40 agonism, activation of tumor-infiltrating immune cells, antitumor efficacy and the role of delivery of tumor-derived material such as extracellular vesicles, tumor debris and exosomes by the CD40×TAA bispecific antibodies were demonstrated in vitro using primary human and murine cells and in vivo using human CD40 transgenic mice with different tumor models. |
| 37742368 | Long-term hypoxic hUCMSCs-derived extracellular vesicles alleviates allergic rhinitis through triggering immunotolerance of their VEGF-mediated inhibition of dendritic cells maturation. | Long-term hypoxic hUCMSCs-derived extracellular vesicles alleviates allergic rhinitis through triggering immunotolerance of their VEGF-mediated inhibition of dendritic cells maturation. |