Protein detail
FOLR1
Folate receptor alpha (FR-alpha) (Adult folate-binding protein) (FBP) (Folate receptor 1) (Folate receptor, adult) (KB cells FBP) (Ovarian tumor-associated antigen MOv18)
Entry name FOLR1 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 2 | Transmembrane count | Protein classification |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Folate receptor alpha (FR-alpha) (Adult folate-binding protein) (FBP) (Folate receptor 1) (Folate receptor, adult) (KB cells FBP) (Ovarian tumor-associated antigen MOv18)
Protein Function (6)
- Transporters
- Human disease related genes:Nervous system diseases:Neurodegenerative diseases
- Predicted secreted proteins
- Disease related genes
- FDA approved drug targets:Small molecule drugs
- FDA approved drug targets:Biotech drugs
Ensembl
Entrez Gene Symbol
Supporting publications (n)
2
EVMP confidence score
0.53
Fluorescence & Localization
Tissue SpecificesophagusCell SpecificBasal keratinocytesSingle-Nuclei Brain Specificeccentric medium spiny neuron
Function & Pathway
Protein Function (6)
- Transporters
- Human disease related genes:Nervous system diseases:Neurodegenerative diseases
- Predicted secreted proteins
- Disease related genes
- FDA approved drug targets:Small molecule drugs
- FDA approved drug targets:Biotech drugs
Cellular Component (16)
- GO:0000139 Golgi membrane
- GO:0005634 nucleus
- GO:0005768 endosome
- GO:0005789 endoplasmic reticulum membrane
- GO:0005886 plasma membrane
- GO:0009897 external side of plasma membrane
- GO:0009986 cell surface
- GO:0012507 ER to Golgi transport vesicle membrane
- GO:0016020 membrane
- GO:0016323 basolateral plasma membrane
Page 1 of 2
Molecular Function (4)
Biological Process (3)
KEGG (4)
Reactome (9)
- R-hsa-446203 asparagine n linked glycosylation
- R-hsa-5694530 cargo concentration in the er
- R-hsa-204005 copii mediated vesicle transport
- R-hsa-6807878 copi mediated anterograde transport
- R-hsa-199977 er to golgi anterograde transport
- R-hsa-199991 membrane trafficking
- R-hsa-597592 post translational protein modification
- R-hsa-948021 transport to the golgi and subsequent modification
- R-hsa-5653656 vesicle mediated transport
Mediation Categories (5)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence42
Ligand-Receptor Signaling (39)
39 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | GO_Intercell | Yes | Yes | Yes | Yes | |
| receptor | receptor | HPMR | Yes | Yes | Yes | Yes | |
| other_receptor_family | receptor | HPMR | Yes | Yes | Yes | Yes | |
| scavenger | receptor | HPMR | Yes | Yes | Yes | Yes | |
| c_lectinn_containing_scavenger_scavenger | receptor | HPMR | Yes | Yes | Yes | Yes | |
| receptor | receptor | OmniPath | Yes | Yes | Yes | Yes | |
| extracellular | extracellular | HPMR | Yes | Yes | Yes | ||
| extracellular | extracellular | DGIdb | Yes | Yes | Yes | ||
| extracellular | extracellular | OmniPath | Yes | Yes | Yes | ||
| intracellular | intracellular | LOCATE | Yes | Yes | Yes |
Page 1 of 4Next
Protein Complex Composition (2)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Protein Organic Solvent Precipitation | Antibody arrayMass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
257
Mass
29,819
Sequence
MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
3D Structural Models
Turn
53..56; 81..83; 86..89; 146..148; 192..195
Helix
31..33; 58..60; 68..73; 94..109; 114..116; 136..145; 172..174; 178..181; 185..191; 216..218; 222..232
Beta Strand
48..50; 63..67; 117..122; 124..126; 150..152; 156..158; 206..210
3D Structure
X-ray crystallography (5)
Domain & Motif Annotations
Protein Families
Folate receptor family
Sequence Similarities
Belongs to the folate receptor family.
Clinical Relevance
Related Diseases (6)
Biomarker
Phase 1; Phase 3; Approved; Phase 2
Supporting Publications2
| PMID | Title | Related sentences |
|---|---|---|
| 33709510 | Unbiased proteomic profiling of host cell extracellular vesicle composition and dynamics upon HIV-1 infection. | No related sentences available |
| 40098346 | Toward Identification of Markers for Brain-Derived Extracellular Vesicles in Cerebrospinal Fluid: A Large-Scale, Unbiased Analysis Using Proximity Extension Assays. | No related sentences available |