Protein detail
FOLR1
Folate receptor alpha (FR-alpha) (Adult folate-binding protein) (FBP) (Folate receptor 1) (Folate receptor, adult) (KB cells FBP) (Ovarian tumor-associated antigen MOv18)
Protein symbol FOLR1 | UniProt ID | EVMP score 0.25 |
Frequency 2 | Transmembrane count | Protein classification |
Basic Information
Protein Names
Folate receptor alpha (FR-alpha) (Adult folate-binding protein) (FBP) (Folate receptor 1) (Folate receptor, adult) (KB cells FBP) (Ovarian tumor-associated antigen MOv18)
Protein Function
- Transporters
- Human disease related genes:Nervous system diseases:Neurodegenerative diseases
- Predicted secreted proteins
- Disease related genes
- FDA approved drug targets:Small molecule drugs
- FDA approved drug targets:Biotech drugs
Ensembl
Entrez Gene Symbol
Frequency
2
EVMP Score
0.25
Fluorescence & Localization
Tissue SpecificesophagusCell SpecificBasal keratinocytesSingle-Nuclei Brain Specificeccentric medium spiny neuron
Function & Pathway
Protein Function
- Transporters
- Human disease related genes:Nervous system diseases:Neurodegenerative diseases
- Predicted secreted proteins
- Disease related genes
- FDA approved drug targets:Small molecule drugs
- FDA approved drug targets:Biotech drugs
Cellular Component
- GO:0000139 Golgi membrane
- GO:0005634 nucleus
- GO:0005768 endosome
- GO:0005789 endoplasmic reticulum membrane
- GO:0005886 plasma membrane
- GO:0009897 external side of plasma membrane
- GO:0009986 cell surface
- GO:0012507 ER to Golgi transport vesicle membrane
- GO:0016020 membrane
- GO:0016323 basolateral plasma membrane
- GO:0016324 apical plasma membrane
- GO:0030133 transport vesicle
- GO:0030136 clathrin-coated vesicle
- GO:0031526 brush border membrane
- GO:0033116 endoplasmic reticulum-Golgi intermediate compartment membrane
- GO:0070062 extracellular exosome
Molecular Function
Biological Process
KEGG
Reactome
- R-hsa-446203 asparagine n linked glycosylation
- R-hsa-5694530 cargo concentration in the er
- R-hsa-204005 copii mediated vesicle transport
- R-hsa-6807878 copi mediated anterograde transport
- R-hsa-199977 er to golgi anterograde transport
- R-hsa-199991 membrane trafficking
- R-hsa-597592 post translational protein modification
- R-hsa-948021 transport to the golgi and subsequent modification
- R-hsa-5653656 vesicle mediated transport
Mediation Categories
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
39 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| secreted | secreted | UniProt_location | No | No | Yes | Yes | Yes |
| secreted | secreted | HPA_secretome | No | No | Yes | Yes | Yes |
| secreted | secreted | OmniPath | No | No | Yes | Yes | Yes |
| cell_surface | cell_surface | Surfaceome | No | No | Yes | Yes | Yes |
| cell_surface | cell_surface | OmniPath | No | No | Yes | Yes | Yes |
| receptor | receptor | CellCellInteractions | No | Yes | Yes | Yes | Yes |
| transmembrane | transmembrane_predicted | Phobius | No | No | Yes | Yes | Yes |
| transmembrane_phobius | transmembrane_predicted | Almen2009 | No | No | Yes | Yes | Yes |
| transmembrane_tmhmm | transmembrane_predicted | Almen2009 | No | No | Yes | Yes | Yes |
Page 4 of 4Previous
Regulatory Interaction Network
0 records.
Protein Complex Composition
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Protein Organic Solvent Precipitation | Antibody arrayMass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
257
Mass
29,819
Sequence
MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
3D Structural Models
Turn
53..56; 81..83; 86..89; 146..148; 192..195
Helix
31..33; 58..60; 68..73; 94..109; 114..116; 136..145; 172..174; 178..181; 185..191; 216..218; 222..232
Beta Strand
48..50; 63..67; 117..122; 124..126; 150..152; 156..158; 206..210
3D Structure
X-ray crystallography (5)
Domain & Motif Annotations
Protein Families
Folate receptor family
Sequence Similarities
Belongs to the folate receptor family.
Clinical Relevance
Related Diseases
Biomarker
Phase 1; Phase 3; Approved; Phase 2