Protein detail
ELN
Elastin (Tropoelastin)
Entry name ELN | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted secreted proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Elastin (Tropoelastin)
Protein Class (5)
Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted secreted proteins
Protein Function (6)
- Human disease related genes:Other congenital disorders:Chromosomal abnormalities
- Predicted intracellular proteins
- Human disease related genes:Congenital malformations:Congenital malformations of the circulatory system
- Predicted secreted proteins
- Human disease related genes:Congenital malformations:Congenital malformations of skin
- Disease related genes
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
SVASWBSWS
Gene Description
Elastin
Chromosome
7
Position
74027789-74069907
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Tissue SpecificbrainCell SpecificSchwann cells
Function & Pathway
Protein Function (6)
- Human disease related genes:Other congenital disorders:Chromosomal abnormalities
- Predicted intracellular proteins
- Human disease related genes:Congenital malformations:Congenital malformations of the circulatory system
- Predicted secreted proteins
- Human disease related genes:Congenital malformations:Congenital malformations of skin
- Disease related genes
Cellular Component (4)
Molecular Function (4)
Biological Process (3)
Reactome (4)
Canonical Pathways
M17 Pid notch pathway
Mediation Categories
Fusion and delivery mediation
Relations & Evidence22
Ligand-Receptor Signaling (17)
17 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | LOCATE | Yes | ||||
| transmembrane | transmembrane | OmniPath | Yes | ||||
| secreted | secreted | UniProt_keyword | Yes | ||||
| secreted | secreted | UniProt_location | Yes | ||||
| secreted | secreted | HPA_secretome | Yes | ||||
| secreted | secreted | OmniPath | Yes | ||||
| glycoprotein | ecm | Matrisome | Yes | Yes |
Page 2 of 2Previous
Regulatory Interaction Network (2)
2 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| FBLN5 | Q9UBX5 | ELN | P15502 | Yes | Yes | Lit-BM-17SIGNORIntAct | Lit-BM-17:19570982SIGNOR:19570982SIGNOR:18267938IntAct:19570982 | |
| FBLN4 | O95967 | ELN | P15502 | Yes | Yes | WangLit-BM-17SIGNORIntAct | Lit-BM-17:19570982SIGNOR:19570982IntAct:19570982 |
Protein Complex Composition (2)
2 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| HT_DM_Cluster422 | CSNK1G1CSNK1G2CSNK1G3ELN | P15502P78368Q9HCP0Q9Y6M4 | 1:1:1:1 | Compleat | Compleat:HC1600 | 22036573 |
| Reelin complex | RELN | P78509 | 2 | ComplexPortal | intact:EBI-21476058 | 273032682184419110939329147552922826558510612399285884541088057310571240 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Flow cytometry | 1 | 27821849 |
Sequence, Structure & Domains
Sequences
Length
786
Mass
68,398
Sequence
MAGLTAAAPRPGVLLLLLSILHPSRPGGVPGAIPGGVPGGVFYPGAGLGALGGGALGPGGKPLKPVPGGLAGAGLGAGLGAFPAVTFPGALVPGGVADAAAAYKAAKAGAGLGGVPGVGGLGVSAGAVVPQPGAGVKPGKVPGVGLPGVYPGGVLPGARFPGVGVLPGVPTGAGVKPKAPGVGGAFAGIPGVGPFGGPQPGVPLGYPIKAPKLPGGYGLPYTTGKLPYGYGPGGVAGAAGKAGYPTGTGVGPQAAAAAAAKAAAKFGAGAAGVLPGVGGAGVPGVPGAIPGIGGIAGVGTPAAAAAAAAAAKAAKYGAAAGLVPGGPGFGPGVVGVPGAGVPGVGVPGAGIPVVPGAGIPGAAVPGVVSPEAAAKAAAKAAKYGARPGVGVGGIPTYGVGAGGFPGFGVGVGGIPGVAGVPGVGGVPGVGGVPGVGISPEAQAAAAAKAAKYGAAGAGVLGGLVPGAPGAVPGVPGTGGVPGVGTPAAAAAKAAAKAAQFGLVPGVGVAPGVGVAPGVGVAPGVGLAPGVGVAPGVGVAPGVGVAPGIGPGGVAAAAKSAAKVAAKAQLRAAAGLGAGIPGLGVGVGVPGLGVGAGVPGLGVGAGVPGFGAGADEGVRRSLSPELREGDPSSSQHLPSTPSSPRVPGALAAAKAAKYGAAVPGVLGGLGALGGVGIPGGVVGAGPAAAAAAAKAAAKAAQFGLVGAAGLGGLGVGGLGVPGVGGLGGIPPAAAAKAAKYGAAGLGGVLGGAGQFPLGGVAARPGFGLSPIFPGGACLGKACGRKRK
Alternative Products
Event=Alternative splicing; Named isoforms=13; Comment=Additional isoforms seem to exist.; Name=3; IsoId=P15502-3; Sequence=Displayed; Name=1; IsoId=P15502-1; Sequence=VSP_012484, VSP_012485, VSP_012487; Name=2; IsoId=P15502-2; Sequence=VSP_012484, VSP_012487; Name=4; IsoId=P15502-4; Sequence=VSP_012484; Name=5; IsoId=P15502-5; Sequence=VSP_012481, VSP_012484, VSP_012487, VSP_012488; Name=6; IsoId=P15502-6; Sequence=VSP_012483, VSP_012487, VSP_012488; Name=7; IsoId=P15502-7; Sequence=VSP_012479, VSP_012483, VSP_012487, VSP_012488; Name=8; IsoId=P15502-8; Sequence=VSP_012482, VSP_012483, VSP_012486, VSP_012487, VSP_012488; Name=9; IsoId=P15502-9; Sequence=VSP_012485; Name=10; IsoId=P15502-10; Sequence=VSP_012485, VSP_012487; Name=11; IsoId=P15502-11; Sequence=VSP_012480, VSP_012482, VSP_012483, VSP_012487, VSP_012488; Name=12; IsoId=P15502-12; Sequence=VSP_012481, VSP_012483, VSP_012487, VSP_012488; Name=13; IsoId=P15502-13; Sequence=VSP_012483, VSP_012487
Alternative Sequence
45..54; Missing (in isoform 7); 78..180; Missing (in isoform 11); 125; A -> AAPSVP (in isoform 5 and isoform 12); 215..228; Missing (in isoform 8 and isoform 11); 453..500; Missing (in isoform 6, isoform 7, isoform 8, isoform 11, isoform 12 and isoform 13); 453..481; Missing (in isoform 1, isoform 2, isoform 4 and isoform 5); 500; F -> FALLNLA (in isoform 1, isoform 9 and isoform 10); 555..570; AAAKSAAKVAAKAQLR -> G (in isoform 8); 612..644; Missing (in isoform 1, isoform 2, isoform 5, isoform 6, isoform 7, isoform 8, isoform 10, isoform 11, isoform 12 and isoform 13); 740..757; Missing (in isoform 5, isoform 6, isoform 7, isoform 8, isoform 11 and isoform 12)
Domain & Motif Annotations
Compositional Bias
630..645; Low complexity
Region
615..645; Disordered
Protein Families
Elastin family
Sequence Similarities
Belongs to the elastin family.
Clinical Relevance
Disease Involvement
Williams-Beuren syndrome
Related Diseases
Drugs (3)
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 32384937 | Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles. | No related sentences available |