Protein detail
MUC1
Mucin-1 (MUC-1) (Breast carcinoma-associated antigen DF3) (Cancer antigen 15-3) (CA 15-3) (Carcinoma-associated mucin) (Episialin) (H23AG) (Krebs von den Lungen-6) (KL-6) (PEMT) (Peanut-reactive urinary mucin) (PUM) (Polymorphic epithelial mucin) (PEM) (Tumor-associated epithelial membrane antigen) (EMA) (Tumor-associated mucin) (CD antigen CD227) [Cleaved into: Mucin-1 subunit alpha (MUC1-NT) (MUC1-alpha); Mucin-1 subunit beta (MUC1-beta) (MUC1-CT)]
Entry name MUC1 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 6 | Transmembrane count 1 | Protein classification Cancer-related genesCD markersDisease related genesHuman disease related genesPredicted intracellular proteinsPredicted membrane proteinsPredicted secreted proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Mucin-1 (MUC-1) (Breast carcinoma-associated antigen DF3) (Cancer antigen 15-3) (CA 15-3) (Carcinoma-associated mucin) (Episialin) (H23AG) (Krebs von den Lungen-6) (KL-6) (PEMT) (Peanut-reactive urinary mucin) (PUM) (Polymorphic epithelial mucin) (PEM) (Tumor-associated epithelial membrane antigen) (EMA) (Tumor-associated mucin) (CD antigen CD227) [Cleaved into: Mucin-1 subunit alpha (MUC1-NT) (MUC1-alpha); Mucin-1 subunit beta (MUC1-beta) (MUC1-CT)]
Protein Class (7)
Cancer-related genesCD markersDisease related genesHuman disease related genesPredicted intracellular proteinsPredicted membrane proteinsPredicted secreted proteins
Protein Function (7)
- Human disease related genes:Urinary system diseases:Kidney diseases
- Predicted intracellular proteins
- Human disease related genes:Congenital malformations:Congenital malformations of the urinary system
- CD markers
- Cancer-related genes:Candidate cancer biomarkers
- Predicted secreted proteins
- Disease related genes
Transmembrane
1159..1181; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (11)
ADMCKDADMCKD1Ca15-3CD227EMAKL-6MCDMCKDMCKD1PEMPUM
Gene Description
Mucin 1, cell surface associated
Chromosome
1
Position
155185824-155192916
Supporting publications (n)
6
EVMP confidence score
0.50
Fluorescence & Localization
Tissue SpecifickidneyCell SpecificAlveolar cells type 1
Function & Pathway
Protein Function (7)
- Human disease related genes:Urinary system diseases:Kidney diseases
- Predicted intracellular proteins
- Human disease related genes:Congenital malformations:Congenital malformations of the urinary system
- CD markers
- Cancer-related genes:Candidate cancer biomarkers
- Predicted secreted proteins
- Disease related genes
Cellular Component (8)
Molecular Function (4)
Biological Process (3)
Reactome (20)
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-5621481 c type lectin receptors clrs
- R-hsa-5621480 dectin 2 family
- R-hsa-5083632 defective c1galt1c1 causes tnps
- R-hsa-5083625 defective galnt3 causes hftc
- R-hsa-9734767 developmental cell lineages
- R-hsa-9734779 developmental cell lineages of the integumentary system
- R-hsa-9924644 developmental lineages of the mammary gland
- R-hsa-9927426 developmental lineage of mammary gland alveolar cells
- R-hsa-9927418 developmental lineage of mammary gland luminal epithelial cells
Page 1 of 2
Mediation Categories (5)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediation
Relations & Evidence82
Enzyme-Mediated Modification (25)
25 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| MUC1 | PRKCD | Q05655 | T | 1,224 | phosphorylation | SIGNORProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | phosphoELM:11877440ProtMapper:11877440SIGNOR:11877440KEA:11877440 |
| MUC1 | PRKCD | Q05655 | T | 242 | phosphorylation | HPRDKEA | HPRD:11877440KEA:11877440 |
| MUC1 | PRKCD | Q05655 | T | 233 | phosphorylation | HPRDKEA | HPRD:11877440KEA:11877440 |
| MUC1 | PRKCD | Q05655 | T | 224 | phosphorylation | HPRDKEA | HPRD:11877440KEA:11877440 |
| MUC1 | GSK3B | P49841 | S | 1,227 | phosphorylation | SIGNORProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | KEA:9819408ProtMapper:9819408SIGNOR:9819408phosphoELM:9819408 |
| MUC1 | GSK3B | P49841 | S | 227 | phosphorylation | KEA | KEA:9819408 |
| MUC1 | GSK3B | P49841 | S | 236 | phosphorylation | KEA | KEA:9819408 |
| MUC1 | GSK3B | P49841 | S | 245 | phosphorylation | KEA | KEA:9819408 |
| MUC1 | EGFR | P00533 | Y | 1,229 | phosphorylation | BEL-Large-Corpus_ProtMapperSIGNORProtMapperKEAphosphoELMLi2012SIGNOR_ProtMapper | ProtMapper:11483589KEA:14521915ProtMapper:15212693KEA:11152665KEA:11483589phosphoELM:11483589SIGNOR:11483589 |
| MUC1 | EGFR | P00533 | Y | 247 | phosphorylation | HPRDKEA | KEA:11483589HPRD:11483589 |
Page 1 of 3Next
Ligand-Receptor Signaling (42)
42 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| plasma_membrane | plasma_membrane | UniProt_location | Yes | Yes | |||
| plasma_membrane | plasma_membrane | Cellinker | Yes | Yes | |||
| apical_cell_membrane | plasma_membrane | UniProt_location | Yes | Yes | |||
| apical_cell_membrane | plasma_membrane | Ramilowski_location | Yes | Yes | |||
| plasma_membrane | plasma_membrane | Ramilowski_location | Yes | Yes | |||
| plasma_membrane | plasma_membrane | OmniPath | Yes | Yes | |||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | Membranome | Yes | Yes | |||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | Yes | Yes | |||
| secreted | secreted | UniProt_keyword | Yes | Yes | |||
| secreted | secreted | HPA_secretome | Yes | Yes |
Regulatory Interaction Network (11)
11 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| PGFRB | P09619 | MUC1 | P15941 | Yes | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetProtMapperdbPTMPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:17545600PhosphoSite:16507569dbPTM:18083107dbPTM:14521915dbPTM:17545600 |
Page 2 of 2Previous
Protein Complex Composition (3)
3 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| c-Src-Muc1 complex | CSKMUC1 | P15941P41240 | 1:1 | Compleat | Compleat:HC1549 | 15897873 |
| MUC1 | P15941 | 2 | PDB | PDB:5t6pPDB:8s6vPDB:2acmPDB:5t78PDB:6bscPDB:8s6kPDB:6bsbPDB:7vacPDB:8p6iPDB:7vazPDB:7v8q | ||
| MUC16 | Q8WXI7 | 2 | PDB | PDB:8vrsPDB:7sa9 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 37713494 |
Sequence, Structure & Domains
Sequences
Length
1,255
Mass
122,102
Sequence
MTPGTQSPFFLLLLLTVLTVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNAVSMTSSVLSSHSPGSGSSTTQGQDVTLAPATEPASGSAATWGQDVTSVPVTRPALGSTTPPAHDVTSAPDNKPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDNRPALGSTAPPVHNVTSASGSASGSASTLVHNGTSARATTTPASKSTPFSIPSHHSDTPTTLASHSTKTDASSTHHSSVPPLTSSNHSTSPQLSTGVSFFFLSFHISNLQFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWGIALLVLVCVLVALAIVYLIALAVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL
Alternative Products
Event=Alternative splicing; Named isoforms=17; Comment=Additional isoforms seem to exist.; Name=1; Synonyms=A; IsoId=P15941-1; Sequence=Displayed; Name=2; Synonyms=B; IsoId=P15941-2; Sequence=VSP_003280; Name=3; Synonyms=C; IsoId=P15941-3; Sequence=VSP_003281; Name=4; Synonyms=D; IsoId=P15941-4; Sequence=VSP_003282; Name=5; Synonyms=SEC; IsoId=P15941-5; Sequence=VSP_003288, VSP_003289; Name=6; Synonyms=X; IsoId=P15941-6; Sequence=VSP_003283, VSP_003284; Name=Y; Synonyms=MUC1/Y; IsoId=P15941-7; Sequence=VSP_003285; Name=8; Synonyms=Z; IsoId=P15941-8; Sequence=VSP_003286; Name=9; Synonyms=S; IsoId=P15941-9; Sequence=VSP_003286, VSP_003287; Name=F; IsoId=P15941-10; Sequence=VSP_035046, VSP_035047; Name=Y-LSP; IsoId=P15941-11; Sequence=VSP_003280, VSP_003285; Name=S2; IsoId=P15941-12; Sequence=VSP_003280, VSP_003285, VSP_003287; Name=M6; IsoId=P15941-13; Sequence=VSP_003286, VSP_046962, VSP_046963; Name=ZD; Synonyms=J19; IsoId=P15941-14; Sequence=VSP_047575, VSP_047576; Name=T10; IsoId=P15941-15; Sequence=VSP_003280, VSP_047873; Name=E2; IsoId=P15941-16; Sequence=VSP_003280, VSP_047872; Name=J13; IsoId=P15941-17; Sequence=VSP_003280, VSP_003285, VSP_047874
Alternative Sequence
19..21; Missing (in isoform 3); 19; T -> TATTAPKPAT (in isoform 2, isoform Y-LSP, isoform E2, isoform J13, isoform S2 and isoform T10); 20..31; Missing (in isoform 4); 54..1151; Missing (in isoform E2); 54..1093; Missing (in isoform T10); 54..1053; Missing (in isoform J13, isoform Y, isoform Y-LSP and isoform S2); 54..1035; Missing (in isoform 8, isoform 9 and isoform M6); 54..96; VSMTSSVLSSHSPGSGSSTTQGQDVTLAPATEPASGSAATWGQ -> IPAPTTTKSCRETFLKCFCRFINKGVFWASPILSSGQDLWWYN (in isoform ZD); 54..87; VSMTSSVLSSHSPGSGSSTTQGQDVTLAPATEPA -> IPAPTTTKSCRETFLKCFCRFINKGVFWASPILS (in isoform F); 54..70; VSMTSSVLSSHSPGSGS -> IPAPTTTKSCRETFLKW (in isoform 6); 71..1095; Missing (in isoform 6); 88..1139; Missing (in isoform F); 97..1255; Missing (in isoform ZD); 1077..1181; Missing (in isoform 9 and isoform S2); 1077..1087; FLQIYKQGGFL -> VSIGLSFPMLP (in isoform 5); 1088..1255; Missing (in isoform 5); 1141..1180; VSDVPFPFSAQSGAGVPGWGIALLVLVCVLVALAIVYLIA -> GCLSVPPKELRAAGHLSSPGYLPSYERVPHLPHPWALCAP (in isoform M6); 1181..1255; Missing (in isoform M6); 1232..1255; VSAGNGGSSLSYTNPAVAATSANL -> RQNGWSTMPRGALPEESQG (in isoform J13)
3D Structural Models
Turn
1082..1085; 1109..1111
Helix
1056..1059; 1064..1080; 1114..1132
Beta Strand
1042..1052; 1086..1096; 1099..1107; 1136..1142
3D Structure
NMR spectroscopy (1); X-ray crystallography (22)
Domain & Motif Annotations
Compositional Bias
38..54; Polar residues; 55..75; Low complexity; 90..102; Polar residues; 960..970; Low complexity; 971..993; Polar residues; 1001..1033; Polar residues
Repeat
61..80; 1; approximate; 81..100; 2; approximate; 101..120; 3; 121..140; 4; 141..160; 5; 161..180; 6; 181..200; 7; 201..220; 8; 221..240; 9; 241..260; 10; 261..280; 11; 281..300; 12; 301..320; 13; 321..340; 14; 341..360; 15; 361..380; 16; 381..400; 17; 401..420; 18; 421..440; 19; 441..460; 20; 461..480; 21; 481..500; 22; 501..520; 23; 521..540; 24; 541..560; 25; 561..580; 26; 581..600; 27; 601..620; 28; 621..640; 29; 641..660; 30; 661..680; 31; 681..700; 32; 701..720; 33; 721..740; 34; 741..760; 35; 761..780; 36; 781..800; 37; 801..820; 38; 821..840; 39; 841..860; 40; 861..880; 41; 881..900; 42; 901..920; 43; 921..940; 44; 941..960; 45; 961..980; 46; approximate; 981..1000; 47; approximate; 1001..1020; 48; approximate
Motif
1203..1206; Interaction with GRB2; 1229..1232; Interaction with SRC and ESR1; 1243..1246; Required for interaction with AP1S2
Domain (FT)
1039..1148; SEA
Region
23..1033; Disordered; 126..965; 42 X 20 AA approximate tandem repeats of P-A-P-G-S-T-A-P-P-A-H-G-V-T-S-A-P-D-T-R; 1192..1228; Interaction with P53; 1214..1237; Disordered; 1223..1230; Required for interaction with GSK3B; 1233..1241; Required for interaction with beta- and gamma-catenins
Clinical Relevance
Disease Involvement (2)
Cancer-related genesTumor suppressor
Related Diseases (14)
Biomarker
Phase 2; Phase 2/3; Phase 1/2; Phase 1; Phase 3
Drug Targets (2)
Clinical trial targetLiterature-reported target
Drugs (23)
-SAR 566658.00NULLLIPOSOMAL MUC1/PET-LIPID A VACCINE ONT-10MESMULOGENE ANCOVACIVECHEXAMETHYLENE BISACETAMIDESODIUM BUTYRATEAS-1403EPITUMOMAB CITUXETANFAS LIGANDCMB-401SONTUZUMABHUHMFG1CANTUZUMAB MERTANSINEPEMTUMOMABYTTRIUM (90Y) CLIVATUZUMAB TETRAXETANIMMUCINCANTUZUMAB RAVTANSINEEMEPEPIMUT-SAR-20.5HUPAM4GATIPOTUZUMABGO-203-2CEPITUMOMAB
Interaction Protein (3)
ENSG00000097007ENSG00000146648ENSG00000197122
Interaction Count
3
Interaction Dataset
intact_biogrid
Supporting Publications6
| PMID | Title | Related sentences |
|---|---|---|
| 30646616 | Preferential Localization of MUC1 Glycoprotein in Exosomes Secreted by Non-Small Cell Lung Carcinoma Cells. | THBS1, ANXA6, HIST1H4A, COL18A1, MDK, SRGN, ENO1, TUBA4A, SLC3A2, GPI, MIF, MUC1, TALDO1, SLC7A5, ICAM1, HSP90AA1, G6PD, and LRP1 were found to be expressed in exosomes at more than 5-fold higher level as compared to total cellular membrane proteins. |
| 32089743 | Human umbilical cord mesenchymal stromal cells-derived extracellular vesicles exert potent bone protective effects by CLEC11A-mediated regulation of bone metabolism. | No related sentences available |
| 33709510 | Unbiased proteomic profiling of host cell extracellular vesicle composition and dynamics upon HIV-1 infection. | No related sentences available |
| 34817906 | Proteomic dissection of large extracellular vesicle surfaceome unravels interactive surface platform. | No related sentences available |
| 35611462 | Extracellular vesicles expressing CEACAM proteins in the urine of bladder cancer patients. | No related sentences available |
| 38321535 | Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles. | No related sentences available |