Protein detail

MUC1

Mucin-1 (MUC-1) (Breast carcinoma-associated antigen DF3) (Cancer antigen 15-3) (CA 15-3) (Carcinoma-associated mucin) (Episialin) (H23AG) (Krebs von den Lungen-6) (KL-6) (PEMT) (Peanut-reactive urinary mucin) (PUM) (Polymorphic epithelial mucin) (PEM) (Tumor-associated epithelial membrane antigen) (EMA) (Tumor-associated mucin) (CD antigen CD227) [Cleaved into: Mucin-1 subunit alpha (MUC1-NT) (MUC1-alpha); Mucin-1 subunit beta (MUC1-beta) (MUC1-CT)]

Entry name
MUC1
UniProt ID
EVMP confidence score
0.50
Supporting publications (n)
6
Transmembrane count
1
Protein classification
Cancer-related genesCD markersDisease related genesHuman disease related genesPredicted intracellular proteinsPredicted membrane proteinsPredicted secreted proteins
Basic Information
Protein Names
Mucin-1 (MUC-1) (Breast carcinoma-associated antigen DF3) (Cancer antigen 15-3) (CA 15-3) (Carcinoma-associated mucin) (Episialin) (H23AG) (Krebs von den Lungen-6) (KL-6) (PEMT) (Peanut-reactive urinary mucin) (PUM) (Polymorphic epithelial mucin) (PEM) (Tumor-associated epithelial membrane antigen) (EMA) (Tumor-associated mucin) (CD antigen CD227) [Cleaved into: Mucin-1 subunit alpha (MUC1-NT) (MUC1-alpha); Mucin-1 subunit beta (MUC1-beta) (MUC1-CT)]
Protein Class (7)
Cancer-related genesCD markersDisease related genesHuman disease related genesPredicted intracellular proteinsPredicted membrane proteinsPredicted secreted proteins
Protein Function (7)
  • Human disease related genes:Urinary system diseases:Kidney diseases
  • Predicted intracellular proteins
  • Human disease related genes:Congenital malformations:Congenital malformations of the urinary system
  • CD markers
  • Cancer-related genes:Candidate cancer biomarkers
  • Predicted secreted proteins
  • Disease related genes
Transmembrane
1159..1181; Helical
Transmembrane Count
1
Entrez Gene Symbol
Gene Synonym (11)
ADMCKDADMCKD1Ca15-3CD227EMAKL-6MCDMCKDMCKD1PEMPUM
Gene Description
Mucin 1, cell surface associated
Chromosome
1
Position
155185824-155192916
Supporting publications (n)
6
EVMP confidence score
0.50
Fluorescence & Localization
MUC1 fluorescence
Tissue SpecifickidneyCell SpecificAlveolar cells type 1
Function & Pathway
Protein Function (7)
  • Human disease related genes:Urinary system diseases:Kidney diseases
  • Predicted intracellular proteins
  • Human disease related genes:Congenital malformations:Congenital malformations of the urinary system
  • CD markers
  • Cancer-related genes:Candidate cancer biomarkers
  • Predicted secreted proteins
  • Disease related genes
Mediation Categories (5)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediation
Relations & Evidence82

Enzyme-Mediated Modification (25)

25 records.

Substrate Gene SymbolEnzyme Gene SymbolEnzyme UniProt IDResidue TypeResidue OffsetModificationDatabaseReferences
MUC1EGFRP00533Y238phosphorylationHPRDKEAKEA:11483589HPRD:11152665HPRD:11483589KEA:11152665
MUC1EGFRP00533Y229phosphorylationHPRDKEAKEA:11483589HPRD:11152665HPRD:11483589KEA:11152665
MUC1SRCP12931Y1,229phosphorylationBEL-Large-Corpus_ProtMapperSIGNORProtMapperKEAphosphoELMLi2012SIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapperKEA:14521915ProtMapper:15212693SIGNOR:11152665KEA:11152665ProtMapper:11152665phosphoELM:11152665KEA:11483589
MUC1ABL1P00519Y1,243phosphorylationSIGNORKEAphosphoELMLi2012PhosphoSiteKEA:7664271KEA:14521915KEA:16888623phosphoELM:16888623SIGNOR:16888623
MUC1PDGFRBP09619Y1,203phosphorylationdbPTMPhosphoSitePhosphoSite_ProtMapperProtMapperdbPTM:14521915dbPTM:17545600dbPTM:18083107
MUC1PDGFRBP09619Y1,218phosphorylationdbPTMPhosphoSitePhosphoSite_ProtMapperProtMapperdbPTM:18083107dbPTM:17545600
MUC1CSKP41240Y1,229phosphorylationdbPTMdbPTM:11483589dbPTM:18083107dbPTM:14521915dbPTM:17545600dbPTM:11152665
MUC1LCKP06239Y1,229phosphorylationSIGNOR_ProtMapperSIGNORProtMapperProtMapper:14766232SIGNOR:14766232
MUC1ZAP70P43403Y1,203phosphorylationSIGNOR_ProtMapperSIGNORProtMapperProtMapper:14766232SIGNOR:14766232
MUC1ZAP70P43403Y1,229phosphorylationKEAKEA:14766232
Page 2 of 3PreviousNext

Ligand-Receptor Signaling (42)

42 records.

CategoryParentDatabaseTransmitterReceiverSecretedPlasma Membrane (Transmembrane)Plasma Membrane (Peripheral)
transmembrane_sosuitransmembrane_predictedAlmen2009YesYes
transmembrane_tmhmmtransmembrane_predictedAlmen2009YesYes
Page 5 of 5Previous

Regulatory Interaction Network (11)

11 records.

Source Protein SymbolSource UniProt IDTarget Protein SymbolTarget UniProt IDIs DirectedIs StimulationIs InhibitionDatabaseReferences
PGFRBP09619MUC1P15941YesphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetProtMapperdbPTMPhosphoSitePhosphoSite_ProtMapperPhosphoSite:17545600PhosphoSite:16507569dbPTM:18083107dbPTM:14521915dbPTM:17545600
Page 2 of 2Previous

Protein Complex Composition (3)

3 records.

Component NameComponent Gene SymbolsComponent UniProt IDStoichiometryDatabaseDatabase IDsReferences
c-Src-Muc1 complexCSKMUC1P15941P412401:1CompleatCompleat:HC154915897873
MUC1P159412PDBPDB:5t6pPDB:8s6vPDB:2acmPDB:5t78PDB:6bscPDB:8s6kPDB:6bsbPDB:7vacPDB:8p6iPDB:7vazPDB:7v8q
MUC16Q8WXI72PDBPDB:8vrsPDB:7sa9

Isolation & Detection Technology (1)

1 record.

EV Isolation MethodDetection MethodNumber of ReferencesReferences
Differential UltracentrifugationMass spectrometry137713494
Sequence, Structure & Domains

Sequences

Length
1,255
Mass
122,102
Sequence
MTPGTQSPFFLLLLLTVLTVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNAVSMTSSVLSSHSPGSGSSTTQGQDVTLAPATEPASGSAATWGQDVTSVPVTRPALGSTTPPAHDVTSAPDNKPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDNRPALGSTAPPVHNVTSASGSASGSASTLVHNGTSARATTTPASKSTPFSIPSHHSDTPTTLASHSTKTDASSTHHSSVPPLTSSNHSTSPQLSTGVSFFFLSFHISNLQFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWGIALLVLVCVLVALAIVYLIALAVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL
Alternative Products
Event=Alternative splicing; Named isoforms=17; Comment=Additional isoforms seem to exist.; Name=1; Synonyms=A; IsoId=P15941-1; Sequence=Displayed; Name=2; Synonyms=B; IsoId=P15941-2; Sequence=VSP_003280; Name=3; Synonyms=C; IsoId=P15941-3; Sequence=VSP_003281; Name=4; Synonyms=D; IsoId=P15941-4; Sequence=VSP_003282; Name=5; Synonyms=SEC; IsoId=P15941-5; Sequence=VSP_003288, VSP_003289; Name=6; Synonyms=X; IsoId=P15941-6; Sequence=VSP_003283, VSP_003284; Name=Y; Synonyms=MUC1/Y; IsoId=P15941-7; Sequence=VSP_003285; Name=8; Synonyms=Z; IsoId=P15941-8; Sequence=VSP_003286; Name=9; Synonyms=S; IsoId=P15941-9; Sequence=VSP_003286, VSP_003287; Name=F; IsoId=P15941-10; Sequence=VSP_035046, VSP_035047; Name=Y-LSP; IsoId=P15941-11; Sequence=VSP_003280, VSP_003285; Name=S2; IsoId=P15941-12; Sequence=VSP_003280, VSP_003285, VSP_003287; Name=M6; IsoId=P15941-13; Sequence=VSP_003286, VSP_046962, VSP_046963; Name=ZD; Synonyms=J19; IsoId=P15941-14; Sequence=VSP_047575, VSP_047576; Name=T10; IsoId=P15941-15; Sequence=VSP_003280, VSP_047873; Name=E2; IsoId=P15941-16; Sequence=VSP_003280, VSP_047872; Name=J13; IsoId=P15941-17; Sequence=VSP_003280, VSP_003285, VSP_047874
Alternative Sequence
19..21; Missing (in isoform 3); 19; T -> TATTAPKPAT (in isoform 2, isoform Y-LSP, isoform E2, isoform J13, isoform S2 and isoform T10); 20..31; Missing (in isoform 4); 54..1151; Missing (in isoform E2); 54..1093; Missing (in isoform T10); 54..1053; Missing (in isoform J13, isoform Y, isoform Y-LSP and isoform S2); 54..1035; Missing (in isoform 8, isoform 9 and isoform M6); 54..96; VSMTSSVLSSHSPGSGSSTTQGQDVTLAPATEPASGSAATWGQ -> IPAPTTTKSCRETFLKCFCRFINKGVFWASPILSSGQDLWWYN (in isoform ZD); 54..87; VSMTSSVLSSHSPGSGSSTTQGQDVTLAPATEPA -> IPAPTTTKSCRETFLKCFCRFINKGVFWASPILS (in isoform F); 54..70; VSMTSSVLSSHSPGSGS -> IPAPTTTKSCRETFLKW (in isoform 6); 71..1095; Missing (in isoform 6); 88..1139; Missing (in isoform F); 97..1255; Missing (in isoform ZD); 1077..1181; Missing (in isoform 9 and isoform S2); 1077..1087; FLQIYKQGGFL -> VSIGLSFPMLP (in isoform 5); 1088..1255; Missing (in isoform 5); 1141..1180; VSDVPFPFSAQSGAGVPGWGIALLVLVCVLVALAIVYLIA -> GCLSVPPKELRAAGHLSSPGYLPSYERVPHLPHPWALCAP (in isoform M6); 1181..1255; Missing (in isoform M6); 1232..1255; VSAGNGGSSLSYTNPAVAATSANL -> RQNGWSTMPRGALPEESQG (in isoform J13)

3D Structural Models

Turn
1082..1085; 1109..1111
Helix
1056..1059; 1064..1080; 1114..1132
Beta Strand
1042..1052; 1086..1096; 1099..1107; 1136..1142
3D Structure
NMR spectroscopy (1); X-ray crystallography (22)

Domain & Motif Annotations

Compositional Bias
38..54; Polar residues; 55..75; Low complexity; 90..102; Polar residues; 960..970; Low complexity; 971..993; Polar residues; 1001..1033; Polar residues
Repeat
61..80; 1; approximate; 81..100; 2; approximate; 101..120; 3; 121..140; 4; 141..160; 5; 161..180; 6; 181..200; 7; 201..220; 8; 221..240; 9; 241..260; 10; 261..280; 11; 281..300; 12; 301..320; 13; 321..340; 14; 341..360; 15; 361..380; 16; 381..400; 17; 401..420; 18; 421..440; 19; 441..460; 20; 461..480; 21; 481..500; 22; 501..520; 23; 521..540; 24; 541..560; 25; 561..580; 26; 581..600; 27; 601..620; 28; 621..640; 29; 641..660; 30; 661..680; 31; 681..700; 32; 701..720; 33; 721..740; 34; 741..760; 35; 761..780; 36; 781..800; 37; 801..820; 38; 821..840; 39; 841..860; 40; 861..880; 41; 881..900; 42; 901..920; 43; 921..940; 44; 941..960; 45; 961..980; 46; approximate; 981..1000; 47; approximate; 1001..1020; 48; approximate
Motif
1203..1206; Interaction with GRB2; 1229..1232; Interaction with SRC and ESR1; 1243..1246; Required for interaction with AP1S2
Domain (FT)
1039..1148; SEA
Region
23..1033; Disordered; 126..965; 42 X 20 AA approximate tandem repeats of P-A-P-G-S-T-A-P-P-A-H-G-V-T-S-A-P-D-T-R; 1192..1228; Interaction with P53; 1214..1237; Disordered; 1223..1230; Required for interaction with GSK3B; 1233..1241; Required for interaction with beta- and gamma-catenins
Clinical Relevance
Supporting Publications6
PMIDTitleRelated sentences
30646616Preferential Localization of MUC1 Glycoprotein in Exosomes Secreted by Non-Small Cell Lung Carcinoma Cells.THBS1, ANXA6, HIST1H4A, COL18A1, MDK, SRGN, ENO1, TUBA4A, SLC3A2, GPI, MIF, MUC1, TALDO1, SLC7A5, ICAM1, HSP90AA1, G6PD, and LRP1 were found to be expressed in exosomes at more than 5-fold higher level as compared to total cellular membrane proteins.
32089743Human umbilical cord mesenchymal stromal cells-derived extracellular vesicles exert potent bone protective effects by CLEC11A-mediated regulation of bone metabolism.No related sentences available
33709510Unbiased proteomic profiling of host cell extracellular vesicle composition and dynamics upon HIV-1 infection.No related sentences available
34817906Proteomic dissection of large extracellular vesicle surfaceome unravels interactive surface platform.No related sentences available
35611462Extracellular vesicles expressing CEACAM proteins in the urine of bladder cancer patients.No related sentences available
38321535Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles.No related sentences available