Protein detail

CD44

CD44 antigen (CDw44) (Epican) (Extracellular matrix receptor III) (ECMR-III) (GP90 lymphocyte homing/adhesion receptor) (HUTCH-I) (Heparan sulfate proteoglycan) (Hermes antigen) (Hyaluronate receptor) (Phagocytic glycoprotein 1) (PGP-1) (Phagocytic glycoprotein I) (PGP-I) (CD antigen CD44)

Entry name
CD44
UniProt ID
EVMP confidence score
0.88
Supporting publications (n)
64
Transmembrane count
1
Protein classification
Blood group antigen proteinsCancer-related genesCD markersFDA approved drug targetsPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsPredicted secreted proteinsTransporters
EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information13
Protein Names
CD44 antigen (CDw44) (Epican) (Extracellular matrix receptor III) (ECMR-III) (GP90 lymphocyte homing/adhesion receptor) (HUTCH-I) (Heparan sulfate proteoglycan) (Hermes antigen) (Hyaluronate receptor) (Phagocytic glycoprotein 1) (PGP-1) (Phagocytic glycoprotein I) (PGP-I) (CD antigen CD44)
Protein Class (9)
Blood group antigen proteinsCancer-related genesCD markersFDA approved drug targetsPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsPredicted secreted proteinsTransporters
Protein Function (7)
  • Transporters
  • Predicted intracellular proteins
  • Blood group antigen proteins
  • CD markers
  • Cancer-related genes:Candidate cancer biomarkers
  • Predicted secreted proteins
  • FDA approved drug targets:Small molecule drugs
Transmembrane
650..670; Helical
Transmembrane Count
1
Entrez Gene Symbol
Gene Synonym (9)
CD44RCSPG8HCELLINMC56MDU2MDU3MIC4Pgp1
Gene Description
CD44 molecule (Indian blood group)
Chromosome
11
Position
35138882-35232402
Supporting publications (n)
64
EVMP confidence score
0.88
Fluorescence & Localization2
CD44 fluorescence
Tissue Specifictestis
Function & Pathway6
Protein Function (7)
  • Transporters
  • Predicted intracellular proteins
  • Blood group antigen proteins
  • CD markers
  • Cancer-related genes:Candidate cancer biomarkers
  • Predicted secreted proteins
  • FDA approved drug targets:Small molecule drugs
Mediation Categories (6)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence81

Enzyme-Mediated Modification (12)

12 records.

Substrate Gene SymbolEnzyme Gene SymbolEnzyme UniProt IDResidue TypeResidue OffsetModificationDatabaseReferences
CD44PRKCAP17252S672phosphorylationPhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPProtMapperKEAphosphoELMPhosphoSitePhosphoSite_ProtMapperKEA:12032545phosphoELM:12032545
CD44PRKCAP17252S291phosphorylationMIMPKEAphosphoELM_MIMPKEA:12032545
CD44PRKCAP17252S423phosphorylationKEAKEA:12032545
CD44PRKCAP17252S629phosphorylationKEAKEA:12032545
CD44CAMK2AQ9UQM7S706phosphorylationphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapperProtMapper:11463356ProtMapper:9580567SIGNOR:9580567SIGNOR:11463356
CD44PRKACAP17612S697phosphorylationphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapperSIGNOR:16785995ProtMapper:16785995
CD44PRKCBP05771S291phosphorylationMIMPphosphoELM_MIMP
CD44PRKCGP05129S291phosphorylationMIMPphosphoELM_MIMP
CD44PRKCDQ05655S291phosphorylationMIMPphosphoELM_MIMP
CD44PRKCEQ02156S291phosphorylationMIMPphosphoELM_MIMP
Page 1 of 2Next

Ligand-Receptor Signaling (65)

65 records.

CategoryParentDatabaseTransmitterReceiverSecretedPlasma Membrane (Transmembrane)Plasma Membrane (Peripheral)
transmembranetransmembraneUniProt_topologyNoNoYesYesNo
transmembranetransmembraneUniProt_keywordNoNoYesYesNo
transmembrane_predictedtransmembraneOmniPathNoNoYesYesNo
transmembranetransmembraneGO_IntercellNoNoYesYesNo
transmembranetransmembraneCellPhoneDBNoNoYesYesNo
transmembranetransmembraneTopDBNoNoYesYesNo
transmembranetransmembraneLOCATENoNoYesYesNo
transmembranetransmembraneRamilowski_locationNoNoYesYesNo
transmembranetransmembraneOmniPathNoNoYesYesNo
plasma_membraneplasma_membraneUniProt_locationNoNoYesYesNo
Page 4 of 7PreviousNext

Regulatory Interaction Network (3)

3 records.

Source Protein SymbolSource UniProt IDTarget Protein SymbolTarget UniProt IDIs DirectedIs StimulationIs InhibitionDatabaseReferences
ADA10O14672CD44P16070YesYesNoCellTalkDBSIGNORCellTalkDB:18971959SIGNOR:26284334
KCC2AQ9UQM7CD44P16070YesYesNoWangphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetSIGNORProtMapperCui2007SIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapperSIGNOR:9580567SIGNOR:11463356PhosphoSite:1281449ProtMapper:11463356ProtMapper:9580567PhosphoSite:16785995PhosphoSite:11463356PhosphoSite:9580567PhosphoSite:12032545PhosphoSite:19582779PhosphoSite:22865879
KAPCAP17612CD44P16070YesYesNophosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPPhosphoSite_norefSIGNORiPTMnetProtMapperSIGNOR_ProtMapperPhosphoSite_ProtMapperSIGNOR:16785995ProtMapper:16785995

Isolation & Detection Technology (1)

1 record.

EV Isolation MethodDetection MethodNumber of ReferencesReferences
Differential UltracentrifugationWestern BlottingMass SpectrometryElisaFlow Cytometry138014595
Sequence, Structure & Domains13

Sequences

Length
742
Mass
81,538
Sequence
MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATTLMSTSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWEPNEENEDERDRHLSFSGSGIDDDEDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWNPEAHPPLIHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSITLQPTANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDVTGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNRSLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASKSQEMVHLVNKESSETPDQFMTADETRNLQNVDMKIGV
Alternative Products
Event=Alternative splicing; Named isoforms=19; Name=1; Synonyms=CD44; IsoId=P16070-1; Sequence=Displayed; Name=2; Synonyms=CD44SP; IsoId=P16070-2; Sequence=VSP_005303, VSP_005304; Name=3; IsoId=P16070-3; Sequence=VSP_005305, VSP_005306; Name=4; Synonyms=Epidermal; IsoId=P16070-4; Sequence=VSP_005307, VSP_005308; Name=5; IsoId=P16070-5; Sequence=VSP_005313; Name=6; IsoId=P16070-6; Sequence=VSP_005314, VSP_005315; Name=7; IsoId=P16070-7; Sequence=VSP_005316, VSP_005317; Name=8; IsoId=P16070-8; Sequence=VSP_005318, VSP_005319; Name=9; IsoId=P16070-9; Sequence=VSP_005320, VSP_005321; Name=10; Synonyms=CD44E, CD44R1, Epithelial, Keratinocyte; IsoId=P16070-10; Sequence=VSP_005309, VSP_005310; Name=11; Synonyms=CD44R2; IsoId=P16070-11; Sequence=VSP_022797; Name=12; Synonyms=CDw44, Reticulocyte; IsoId=P16070-12; Sequence=VSP_005311, VSP_005312; Name=13; Synonyms=CD44R4; IsoId=P16070-13; Sequence=VSP_005309, VSP_005310, VSP_005318, VSP_005319; Name=14; Synonyms=CD44R5; IsoId=P16070-14; Sequence=VSP_005309, VSP_005310, VSP_005316, VSP_005317, VSP_005318, VSP_005319; Name=15; Synonyms=Hermes; IsoId=P16070-15; Sequence=VSP_005311, VSP_005312, VSP_005320, VSP_005321; Name=16; IsoId=P16070-16; Sequence=VSP_005305, VSP_005306, VSP_005314, VSP_005315; Name=17; IsoId=P16070-17; Sequence=VSP_005313, VSP_005314, VSP_005315; Name=18; IsoId=P16070-18; Sequence=VSP_005311, VSP_005312, VSP_043575; Name=19; Synonyms=CD44RC; IsoId=P16070-19; Sequence=VSP_043870, VSP_043871
Alternative Sequence
23..29; DLNITCR -> GVGRRKS (in isoform 2); 30..742; Missing (in isoform 2); 78..139; RYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAF -> SLHCSQQSKKVWAEEKASDQQWQWSCGGQKAKWTQRRGQQVSGNGAFGEQGVVRNSRPVYDS (in isoform 19); 140..742; Missing (in isoform 19); 192; G -> A (in isoform 3 and isoform 16); 193..223; Missing (in isoform 3 and isoform 16); 223..535; Missing (in isoform 11); 223; T -> N (in isoform 10, isoform 13 and isoform 14); 223; T -> R (in isoform 12, isoform 15 and isoform 18); 223; T -> S (in isoform 4); 224..604; Missing (in isoform 12, isoform 15 and isoform 18); 224..472; Missing (in isoform 10, isoform 13 and isoform 14); 224..266; Missing (in isoform 4); 266..273; Missing (in isoform 5 and isoform 17); 385; I -> T (in isoform 6, isoform 16 and isoform 17); 386..428; Missing (in isoform 6, isoform 16 and isoform 17); 506; Q -> R (in isoform 7 and isoform 14); 507..535; Missing (in isoform 7 and isoform 14); 536; N -> R (in isoform 8, isoform 13 and isoform 14); 537..604; Missing (in isoform 8, isoform 13 and isoform 14); 605..625; Missing (in isoform 18); 675; R -> S (in isoform 9 and isoform 15); 676..742; Missing (in isoform 9 and isoform 15)

3D Structural Models

Turn
150..152
Helix
46..55; 63..71; 98..100; 165..168
Beta Strand
21..26; 33..38; 57..59; 80..82; 85..92; 103..106; 109..111; 114..119; 121..123; 125..128; 130..132; 139..148; 154..160
3D Structure
NMR spectroscopy (2); X-ray crystallography (4)

Domain & Motif Annotations

Compositional Bias
179..189; Low complexity; 261..273; Polar residues; 386..396; Low complexity; 407..421; Basic and acidic residues; 422..435; Low complexity; 439..452; Polar residues; 476..489; Polar residues; 502..516; Low complexity; 528..539; Polar residues; 592..606; Polar residues; 619..629; Basic and acidic residues
Domain (CC)
The lectin-like LINK domain is responsible for hyaluronan binding.
Domain (FT)
32..120; Link
Region
160..189; Disordered; 224..649; Stem; 261..285; Disordered; 372..558; Disordered; 590..642; Disordered; 673..691; Required for interaction with EZR, MSN and RDX and for co-localization to microvilli
Clinical Relevance9
Supporting Publications61
PMIDTitleAbstract
27564521Concomitant Evaluation of a Panel of Exosome Proteins and MiRs for Qualification of Cultured Human Corneal Endothelial Cells.Cultured HCECs sharing a CD44- phenotype of matured HCECs may be discriminated by measuring the amount of miRNAs or exosome in CS.
27758876Exosomes Promote Ovarian Cancer Cell Invasion through Transfer of CD44 to Peritoneal Mesothelial Cells.CD44, a cell surface glycoprotein, was found to be enriched in the cancer cell-derived exosomes, transferred, and internalized to HPMCs, leading to high levels of CD44 in HPMCs. The inhibition of exosome release from cancer cells blocked CD44 internalization in HPMCs and suppressed ovarian cancer invasion. This study indicates that ovarian cancer-derived exosomes transfer CD44 to HPMCs, facilitating cancer invasion. When CD44 expression was knocked down in cancer cells, exosomes had fewer effects on HPMCs.
28895255UBR2 Enriched in p53 Deficient Mouse Bone Marrow Mesenchymal Stem Cell-Exosome Promoted Gastric Cancer Progression via Wnt/β-Catenin Pathway.However, whether the state of p53 in MSCs can impact the bioactive molecule secretion of exosomes to promote cancer progression and the regulatory mechanism remains elusive. Our study aimed to investigate the regulation of ubiquitin protein ligase E3 component n-recognin 2 (UBR2) enriched in exosomes secreted by p53 deficient mouse bone marrow MSC (p53 © 2017 AlphaMed Press.
28928832Downregulation of Rab27A contributes to metformin-induced suppression of breast cancer stem cells.The present study demonstrated that the expression of RAB27A, member RAS oncogene family (Rab27a), which was reported to promote tumor progression by upregulating exocytosis of extracellular vesicles, was higher in mammosphere cells than in adherent MDA-MB-231 breast cancer cells.
29143228Effect of exosome biomarkers for diagnosis and prognosis of breast cancer patients.Exosome biomarkers (such as HER2, CD47, Del-1, miR-1246 and miR-21) in breast cancer patients are significantly higher than those in healthy controls, exosomal GSTP1 and TRPC5 are related to chemotherapy resistance, exosome-carrying TRPC5, NANOG, NEUROD1, HTR7, KISS1R and HOXC are correlated to PFS, DFS or OS, and some exosomal proteins (HER2, KDR, CD49d, CXCR4 and CD44) as well as miRNAs (miR-340-5p, miR-17-5p, miR-130a-3p, miR-93-5p) are associated with tumor recurrence or distant organ metastasis.
30108515Microgravity-Induced Alterations of Inflammation-Related Mechanotransduction in Endothelial Cells on Board SJ-10 Satellite.Meanwhile, it also induced the depolymerization of actin filaments and microtubules, promoted the vimentin accumulation, restrained the collagen I and fibronectin deposition, regulated the mechanotransduction through focal adhesion kinase and Rho GTPases, and enhanced the exosome-mediated mRNA transfer.
30893511Oncogenic and Non-Malignant Pancreatic Exosome Cargo Reveal Distinct Expression of Oncogenic and Prognostic Factors Involved in Tumor Invasion and Metastasis.Importantly, valuable insights into oncogenic exosomes (362 unique proteins in comparison to non-malignant exosomes) of key metastatic regulatory factors and signaling molecules fundamental to pancreatic cancer progression (KRAS, CD44, EGFR) are provided. It is reported that oncogenic exosomes contain factors known to regulate the pre-metastatic niche (S100A4, F3, ITGβ5, ANXA1), clinically-relevant proteins which correlate with poor prognosis (CLDN1, MUC1) as well as protein networks involved in various cancer hallmarks including proliferation (CLU, CAV1), invasion (PODXL, ITGA3), metastasis (LAMP1, ST14) and immune surveillance escape (B2M).
30909497CD44s Assembles Hyaluronan Coat on Filopodia and Extracellular Vesicles and Induces Tumorigenicity of MKN74 Gastric Carcinoma Cells.Recent data has shown that CD44 and its principal ligand hyaluronan (HA) are carried by extracellular vesicles (EV) derived from stem and tumor cells, but the role of CD44 in EV shedding has not been studied so far.
31048929Clinical impact of different exosomes' protein expression in pancreatic ductal carcinoma patients treated with standard first line palliative chemotherapy.Pancreatic cancer patients exosomes express EpCAM, whose levels change during treatment. This represents a useful prognostic factor and also suggests that future treatment modalities who target EpCAM should be tested in pancreatic cancer patients selected by exosome EpCAM expression. We quantified by an ELISA-based technique specific proteins of cancer-derived exosomes (CD44,CD44v6,EpCAM,CD9,CD81,Tspan8,Integrin α6,Integrin β4,CD24,CXCR4).
31184411The Incorporation of Extracellular Vesicles from Mesenchymal Stromal Cells Into CD34+ Cells Increases Their Clonogenic Capacity and Bone Marrow Lodging Ability.The Incorporation of Extracellular Vesicles from Mesenchymal Stromal Cells Into CD34
Page 2 of 7PreviousNext