Protein detail
CD44
CD44 antigen (CDw44) (Epican) (Extracellular matrix receptor III) (ECMR-III) (GP90 lymphocyte homing/adhesion receptor) (HUTCH-I) (Heparan sulfate proteoglycan) (Hermes antigen) (Hyaluronate receptor) (Phagocytic glycoprotein 1) (PGP-1) (Phagocytic glycoprotein I) (PGP-I) (CD antigen CD44)
Entry name CD44 | UniProt ID | EVMP confidence score 0.88 |
Supporting publications (n) 64 | Transmembrane count 1 | Protein classification Blood group antigen proteinsCancer-related genesCD markersFDA approved drug targetsPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsPredicted secreted proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
CD44 antigen (CDw44) (Epican) (Extracellular matrix receptor III) (ECMR-III) (GP90 lymphocyte homing/adhesion receptor) (HUTCH-I) (Heparan sulfate proteoglycan) (Hermes antigen) (Hyaluronate receptor) (Phagocytic glycoprotein 1) (PGP-1) (Phagocytic glycoprotein I) (PGP-I) (CD antigen CD44)
Protein Class (9)
Blood group antigen proteinsCancer-related genesCD markersFDA approved drug targetsPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsPredicted secreted proteinsTransporters
Protein Function (7)
- Transporters
- Predicted intracellular proteins
- Blood group antigen proteins
- CD markers
- Cancer-related genes:Candidate cancer biomarkers
- Predicted secreted proteins
- FDA approved drug targets:Small molecule drugs
Transmembrane
650..670; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (9)
CD44RCSPG8HCELLINMC56MDU2MDU3MIC4Pgp1
Gene Description
CD44 molecule (Indian blood group)
Chromosome
11
Position
35138882-35232402
Supporting publications (n)
64
EVMP confidence score
0.88
Fluorescence & Localization2
Tissue Specifictestis
Function & Pathway6
Protein Function (7)
- Transporters
- Predicted intracellular proteins
- Blood group antigen proteins
- CD markers
- Cancer-related genes:Candidate cancer biomarkers
- Predicted secreted proteins
- FDA approved drug targets:Small molecule drugs
Cellular Component (13)
- GO:0005794 Golgi apparatus
- GO:0005829 cytosol
- GO:0005886 plasma membrane
- GO:0005902 microvillus
- GO:0005925 focal adhesion
- GO:0009986 cell surface
- GO:0016323 basolateral plasma membrane
- GO:0016324 apical plasma membrane
- GO:0030667 secretory granule membrane
- GO:0031258 lamellipodium membrane
Page 1 of 2
Molecular Function (5)
KEGG (6)
Reactome (20)
- R-hsa-202733 cell surface interactions at the vascular wall
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-1474228 degradation of the extracellular matrix
- R-hsa-9734767 developmental cell lineages
- R-hsa-9734779 developmental cell lineages of the integumentary system
- R-hsa-9924644 developmental lineages of the mammary gland
- R-hsa-9927418 developmental lineage of mammary gland luminal epithelial cells
- R-hsa-9927432 developmental lineage of mammary gland myoepithelial cells
- R-hsa-9938206 developmental lineage of mammary stem cells
- R-hsa-1474244 extracellular matrix organization
Page 1 of 2
Mediation Categories (6)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence81
Enzyme-Mediated Modification (12)
12 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| CD44 | PRKCA | P17252 | S | 672 | phosphorylation | PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPProtMapperKEAphosphoELMPhosphoSitePhosphoSite_ProtMapper | KEA:12032545phosphoELM:12032545 |
| CD44 | PRKCA | P17252 | S | 291 | phosphorylation | MIMPKEAphosphoELM_MIMP | KEA:12032545 |
| CD44 | PRKCA | P17252 | S | 423 | phosphorylation | KEA | KEA:12032545 |
| CD44 | PRKCA | P17252 | S | 629 | phosphorylation | KEA | KEA:12032545 |
| CD44 | CAMK2A | Q9UQM7 | S | 706 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:11463356ProtMapper:9580567SIGNOR:9580567SIGNOR:11463356 |
| CD44 | PRKACA | P17612 | S | 697 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:16785995ProtMapper:16785995 |
| CD44 | PRKCB | P05771 | S | 291 | phosphorylation | MIMPphosphoELM_MIMP | |
| CD44 | PRKCG | P05129 | S | 291 | phosphorylation | MIMPphosphoELM_MIMP | |
| CD44 | PRKCD | Q05655 | S | 291 | phosphorylation | MIMPphosphoELM_MIMP | |
| CD44 | PRKCE | Q02156 | S | 291 | phosphorylation | MIMPphosphoELM_MIMP |
Page 1 of 2Next
Ligand-Receptor Signaling (65)
65 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | UniProt_topology | No | No | Yes | Yes | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | Yes | Yes | No |
| transmembrane_predicted | transmembrane | OmniPath | No | No | Yes | Yes | No |
| transmembrane | transmembrane | GO_Intercell | No | No | Yes | Yes | No |
| transmembrane | transmembrane | CellPhoneDB | No | No | Yes | Yes | No |
| transmembrane | transmembrane | TopDB | No | No | Yes | Yes | No |
| transmembrane | transmembrane | LOCATE | No | No | Yes | Yes | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | Yes | Yes | No |
| transmembrane | transmembrane | OmniPath | No | No | Yes | Yes | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | Yes | Yes | No |
Regulatory Interaction Network (3)
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| ADA10 | O14672 | CD44 | P16070 | Yes | Yes | No | CellTalkDBSIGNOR | CellTalkDB:18971959SIGNOR:26284334 |
| KCC2A | Q9UQM7 | CD44 | P16070 | Yes | Yes | No | WangphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetSIGNORProtMapperCui2007SIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:9580567SIGNOR:11463356PhosphoSite:1281449ProtMapper:11463356ProtMapper:9580567PhosphoSite:16785995PhosphoSite:11463356PhosphoSite:9580567PhosphoSite:12032545PhosphoSite:19582779PhosphoSite:22865879 |
| KAPCA | P17612 | CD44 | P16070 | Yes | Yes | No | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPPhosphoSite_norefSIGNORiPTMnetProtMapperSIGNOR_ProtMapperPhosphoSite_ProtMapper | SIGNOR:16785995ProtMapper:16785995 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Western BlottingMass SpectrometryElisaFlow Cytometry | 1 | 38014595 |
Sequence, Structure & Domains13
Sequences
Length
742
Mass
81,538
Sequence
MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATTLMSTSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWEPNEENEDERDRHLSFSGSGIDDDEDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWNPEAHPPLIHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSITLQPTANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDVTGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNRSLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASKSQEMVHLVNKESSETPDQFMTADETRNLQNVDMKIGV
Alternative Products
Event=Alternative splicing; Named isoforms=19; Name=1; Synonyms=CD44; IsoId=P16070-1; Sequence=Displayed; Name=2; Synonyms=CD44SP; IsoId=P16070-2; Sequence=VSP_005303, VSP_005304; Name=3; IsoId=P16070-3; Sequence=VSP_005305, VSP_005306; Name=4; Synonyms=Epidermal; IsoId=P16070-4; Sequence=VSP_005307, VSP_005308; Name=5; IsoId=P16070-5; Sequence=VSP_005313; Name=6; IsoId=P16070-6; Sequence=VSP_005314, VSP_005315; Name=7; IsoId=P16070-7; Sequence=VSP_005316, VSP_005317; Name=8; IsoId=P16070-8; Sequence=VSP_005318, VSP_005319; Name=9; IsoId=P16070-9; Sequence=VSP_005320, VSP_005321; Name=10; Synonyms=CD44E, CD44R1, Epithelial, Keratinocyte; IsoId=P16070-10; Sequence=VSP_005309, VSP_005310; Name=11; Synonyms=CD44R2; IsoId=P16070-11; Sequence=VSP_022797; Name=12; Synonyms=CDw44, Reticulocyte; IsoId=P16070-12; Sequence=VSP_005311, VSP_005312; Name=13; Synonyms=CD44R4; IsoId=P16070-13; Sequence=VSP_005309, VSP_005310, VSP_005318, VSP_005319; Name=14; Synonyms=CD44R5; IsoId=P16070-14; Sequence=VSP_005309, VSP_005310, VSP_005316, VSP_005317, VSP_005318, VSP_005319; Name=15; Synonyms=Hermes; IsoId=P16070-15; Sequence=VSP_005311, VSP_005312, VSP_005320, VSP_005321; Name=16; IsoId=P16070-16; Sequence=VSP_005305, VSP_005306, VSP_005314, VSP_005315; Name=17; IsoId=P16070-17; Sequence=VSP_005313, VSP_005314, VSP_005315; Name=18; IsoId=P16070-18; Sequence=VSP_005311, VSP_005312, VSP_043575; Name=19; Synonyms=CD44RC; IsoId=P16070-19; Sequence=VSP_043870, VSP_043871
Alternative Sequence
23..29; DLNITCR -> GVGRRKS (in isoform 2); 30..742; Missing (in isoform 2); 78..139; RYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAF -> SLHCSQQSKKVWAEEKASDQQWQWSCGGQKAKWTQRRGQQVSGNGAFGEQGVVRNSRPVYDS (in isoform 19); 140..742; Missing (in isoform 19); 192; G -> A (in isoform 3 and isoform 16); 193..223; Missing (in isoform 3 and isoform 16); 223..535; Missing (in isoform 11); 223; T -> N (in isoform 10, isoform 13 and isoform 14); 223; T -> R (in isoform 12, isoform 15 and isoform 18); 223; T -> S (in isoform 4); 224..604; Missing (in isoform 12, isoform 15 and isoform 18); 224..472; Missing (in isoform 10, isoform 13 and isoform 14); 224..266; Missing (in isoform 4); 266..273; Missing (in isoform 5 and isoform 17); 385; I -> T (in isoform 6, isoform 16 and isoform 17); 386..428; Missing (in isoform 6, isoform 16 and isoform 17); 506; Q -> R (in isoform 7 and isoform 14); 507..535; Missing (in isoform 7 and isoform 14); 536; N -> R (in isoform 8, isoform 13 and isoform 14); 537..604; Missing (in isoform 8, isoform 13 and isoform 14); 605..625; Missing (in isoform 18); 675; R -> S (in isoform 9 and isoform 15); 676..742; Missing (in isoform 9 and isoform 15)
3D Structural Models
Turn
150..152
Helix
46..55; 63..71; 98..100; 165..168
Beta Strand
21..26; 33..38; 57..59; 80..82; 85..92; 103..106; 109..111; 114..119; 121..123; 125..128; 130..132; 139..148; 154..160
3D Structure
NMR spectroscopy (2); X-ray crystallography (4)
Domain & Motif Annotations
Compositional Bias
179..189; Low complexity; 261..273; Polar residues; 386..396; Low complexity; 407..421; Basic and acidic residues; 422..435; Low complexity; 439..452; Polar residues; 476..489; Polar residues; 502..516; Low complexity; 528..539; Polar residues; 592..606; Polar residues; 619..629; Basic and acidic residues
Domain (CC)
The lectin-like LINK domain is responsible for hyaluronan binding.
Domain (FT)
32..120; Link
Region
160..189; Disordered; 224..649; Stem; 261..285; Disordered; 372..558; Disordered; 590..642; Disordered; 673..691; Required for interaction with EZR, MSN and RDX and for co-localization to microvilli
Clinical Relevance9
Disease Involvement (2)
Cancer-related genesFDA approved drug targets
Related Diseases (3)
Biomarker
Phase 2; Phase 1
Drug Targets
FDA approved drug targets
Drugs (20)
Interaction Protein (2)
ENSG00000147065ENSG00000151012
Interaction Count
2
Interaction Dataset
intact_biogrid
Supporting Publications61
| PMID | Title | Abstract |
|---|---|---|
| 31473497 | Exosomes in specific fractions of the boar ejaculate contain CD44: A marker for epididymosomes? | Noteworthy, these pig SP-exosomes were CD44-bearing when analysed by FC, with bands detected by western blotting (WB) at the expected 85 kD size. The findings pave for the selective isolation of exosomes in functional studies of their function when interacting with spermatozoa, the oocyte and/or the female genitalia, including hyaluronan-CD44 interplay. |
| 31485223 | The Pancreatic Cancer-Initiating Cell Marker CD44v6 Affects Transcription, Translation, and Signaling: Consequences for Exosome Composition and Delivery. | Due to the association of CD44v6 with Tspan8 in internalization prone tetraspanin-enriched membrane domains (TEM) and the engagement of Tspan8 in exosome biogenesis, most CD44v6-dependent changes were transferred into TEX such that the input of CD44v6 to TEX activities becomes largely waved in both a CD44v6kd and a Tspan8kd. |
| 31676071 | Disruption of Core 1-mediated O-glycosylation oppositely regulates CD44 expression in human colon cancer cells and tumor-derived exosomes. | CD44 in exosomes might be a potential biomarker of aberrant O-glycosylation. CD63 immunoaffinity-purified exosomes are examined for CD44 expression by flow cytometric analyses. Exosomes derived from LS174T and LSC human colon cancer cell lines were isolated from cell culture supernatant and pulled down using tetraspanin-specific antibody CD63 immunoaffinity magnetic beads. In this research, we aimed to investigate whether CD44 expression in cells and exosomes can be influenced by disruption of Core 1-mediated O-glycosylation. The percentages of CD44 in exosomes derived from abnormally O-glycosylated cells are significantly higher compared with those derived from normal ones, however, which is surprisingly contrary to the cellular expression levels of CD44. |
| 31786017 | Electrochemical immunosensing of nanovesicles as biomarkers for breast cancer. | To achieve that, the exosomes were preconcentrated from cell-culture supernatant (and eventually in human serum) on magnetic particles modified with antibodies against the general tetraspanins CD9, CD63 and CD81, as well as specific receptors of cancer (CD24, CD44, CD54, CD326 and CD340). |
| 31806995 | Checkpoint CD47 Function On Tumor Metastasis And Immune Therapy. | Meanwhile, tumor cells express high CD47 protein which may secrete exosomes with high CD47 expression. The high CD47 expression-exosomes could serve the tumor metastasis process and provide transfer convenience for tumors on the microenvironment. |
| 31820036 | HAS3-induced extracellular vesicles from melanoma cells stimulate IHH mediated c-Myc upregulation via the hedgehog signaling pathway in target cells. | No abstract available |
| 31894881 | Chicken seminal fluid lacks CD9- and CD44-bearing extracellular vesicles. | In the present study, sperm-free SF from Red Jungle Fowl, White Leghorn and an advanced intercross (AIL, 12th generation) were studied using flow cytometry of the membrane marker tetraspanin CD9, Western blotting of the membrane receptor CD44 and electron microscopy in non-enriched (whole SF) or enriched fractions obtained by precipitation using a commercial kit (Total Exosome Precipitation Solution). Its complex proteome might either be free or linked to extracellular vesicles (EVs) as it is the case in mammals, where EVs depict the tetraspanin CD9; and where those EVs derived from the epididymis (epididymosomes) also present the receptor CD44. |
| 32054015 | Matrix Effect in the Isolation of Breast Cancer-Derived Nanovesicles by Immunomagnetic Separation and Electrochemical Immunosensing-A Comparative Study. | Based on this study, the exosomes were preconcentrated by immunomagnetic separation on antiCD81-modified magnetic particles in order to achieve further magnetic actuation on the surface of the electrode for the electrochemical readout. |
| 32642575 | CD44v8-10 mRNA contained in serum exosomes as a diagnostic marker for docetaxel resistance in prostate cancer patients. | In this study, we examined CD44 protein and mRNA expression in cell lysates and exosomes isolated from prostate cancer cells, evaluated the effect of CD44v8-10 knockdown on docetaxel sensitivity and measured CD44 mRNA copy numbers contained in serum exosomes in prostate cancer patients. The CD44v8-10 mRNA copy numbers in serum exosomes were higher in docetaxel-resistant patients than in docetaxel-naïve patients and control males (median 46, 12 and 17 copies/mL serum, respectively, CD44v8-10 may be involved in docetaxel resistance in prostate cancer and serum exosomal CD44v8-10 mRNA could be a diagnostic marker for docetaxel-resistant CRPC. The levels of CD44v8-10 protein and mRNA in cell lysates and exosomes were higher in PC-3R cells than in PC-3 cells. We hypothesized that CD44 in serum exosomes could be a diagnostic marker for docetaxel resistance in CRPC patients. |
| 32760666 | Enrichment of CD44 in Exosomes From Breast Cancer Cells Treated With Doxorubicin Promotes Chemoresistance. | No abstract available |