Protein detail
DPEP1
Dipeptidase 1 (EC 3.4.13.19) (Beta-lactamase) (EC 3.5.2.6) (Dehydropeptidase-I) (Microsomal dipeptidase) (Renal dipeptidase) (hRDP)
Entry name DPEP1 | UniProt ID | EVMP confidence score 0.63 |
Supporting publications (n) 32 | Transmembrane count | Protein classification EnzymesFDA approved drug targetsMetabolic proteinsPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information10
Protein Names
Dipeptidase 1 (EC 3.4.13.19) (Beta-lactamase) (EC 3.5.2.6) (Dehydropeptidase-I) (Microsomal dipeptidase) (Renal dipeptidase) (hRDP)
Protein Class (4)
EnzymesFDA approved drug targetsMetabolic proteinsPredicted intracellular proteins
Protein Function (4)
- Predicted intracellular proteins
- Enzymes
- FDA approved drug targets:Small molecule drugs
- ENZYME proteins:Hydrolases
Ensembl
Entrez Gene Symbol
Gene Description
Dipeptidase 1
Chromosome
16
Position
89613308-89638456
Supporting publications (n)
32
EVMP confidence score
0.63
Fluorescence & Localization7
Tissue SpecificintestineBrain Regional Specificchoroid plexusCell SpecificColonocytesSingle-Nuclei Brain Specificchoroid plexus epithelial cellBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes
Function & Pathway6
Protein Function (4)
- Predicted intracellular proteins
- Enzymes
- FDA approved drug targets:Small molecule drugs
- ENZYME proteins:Hydrolases
Cellular Component (9)
Molecular Function (9)
- GO:0005515 protein binding
- GO:0008235 metalloexopeptidase activity
- GO:0008270 zinc ion binding
- GO:0008800 beta-lactamase activity
- GO:0016805 dipeptidase activity
- GO:0034235 GPI anchor binding
- GO:0043027 cysteine-type endopeptidase inhibitor activity involved in apoptotic process
- GO:0070573 metallodipeptidase activity
- GO:0072341 modified amino acid binding
Biological Process (3)
Reactome (10)
- R-hsa-5423646 aflatoxin activation and detoxification
- R-hsa-9662851 anti inflammatory response favouring leishmania parasite infection
- R-hsa-2142753 arachidonate metabolism
- R-hsa-211859 biological oxidations
- R-hsa-8978868 fatty acid metabolism
- R-hsa-5663205 infectious disease
- R-hsa-9658195 leishmania infection
- R-hsa-9664535 ltc4 cysltr mediated il4 production
- R-hsa-556833 metabolism of lipids
- R-hsa-2142691 synthesis of leukotrienes lt and eoxins ex
Mediation Categories (4)
Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediation
Relations & Evidence34
Ligand-Receptor Signaling (30)
30 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | CSPA | No | No | No | Yes | Yes |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | No | No | No | Yes | Yes |
| plasma_membrane_peripheral | plasma_membrane_peripheral | CSPA | No | No | No | Yes | Yes |
| plasma_membrane_peripheral | plasma_membrane_peripheral | OmniPath | No | No | No | Yes | Yes |
| cell_surface | cell_surface | Surfaceome | No | No | No | Yes | Yes |
| cell_surface | cell_surface | OmniPath | No | No | No | Yes | Yes |
| receptor | receptor | scConnect | No | Yes | No | Yes | Yes |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | Yes | Yes |
| transmembrane_phobius | transmembrane_predicted | Almen2009 | No | No | No | Yes | Yes |
| transmembrane_sosui | transmembrane_predicted | Almen2009 | No | No | No | Yes | Yes |
Page 3 of 3Previous
Protein Complex Composition (3)
3 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| LeukotrieneE4_byDPEP1 | DPEP1 | P16444 | 2 | CellPhoneDBCellChatDBPDB | PDB:1itqPDB:1ituCellPhoneDB:LeukotrieneE4_byDPEP1 | |
| DPEP1SAYSD1STEAP2SUN1TBL2TMEM258TMUB2VMP1 | O94901P16444P61165Q71RG4Q8NFT2Q96GC9Q9NPB0Q9Y4P3 | 0:0:0:0:0:0:0:0 | hu.MAP2 | |||
| DPEP1SUN1TMUB2 | O94901P16444Q71RG4 | 0:0:0 | hu.MAP2 |
Sequence, Structure & Domains9
Sequences
Length
411
Mass
45,674
Sequence
MWSGWWLWPLVAVCTADFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSSGASSLHRHWGLLLASLAPLVLCLSLL
3D Structural Models
Turn
58..60; 90..93; 113..115; 181..183; 239..241; 305..307; 381..383
Helix
18..27; 39..47; 54..56; 68..73; 87..89; 94..111; 122..131; 143..146; 150..158; 178..180; 194..206; 217..226; 250..259; 269..272; 280..294; 296..298; 321..330; 335..342; 344..356; 370..372
Beta Strand
32..37; 63..65; 76..83; 116..118; 134..141; 161..166; 168..170; 173..175; 188..192; 209..211; 232..235; 262..265; 274..276; 299..301; 359..361; 375..377
3D Structure
X-ray crystallography (2)
Domain & Motif Annotations
Protein Families (2)
- Metallo-dependent hydrolases superfamily
- Peptidase M19 family
Sequence Similarities
Belongs to the metallo-dependent hydrolases superfamily. Peptidase M19 family.
Clinical Relevance9
Disease Involvement
FDA approved drug targets
Related Diseases
Biomarker
Approved
Drug Targets
FDA approved drug targets
Drugs (12)
Interaction Protein
ENSG00000198954
Interaction Count
1
Interaction Dataset
intact_biogrid
Supporting Publications32
| PMID | Title | Abstract |
|---|---|---|
| 3467568 | Diagnostic terminology of head injuries--related to severity. | No abstract available |
| 34889606 | Surface Nanosieving Polyether Sulfone Particles with Graphene Oxide Encapsulation for the Negative Isolation toward Extracellular Vesicles. | No abstract available |
| 36635400 | Proteomic profiling of urinary small extracellular vesicles in children with pneumonia: a pilot study. | No abstract available |
| 37686366 | Identification of a Non-Invasive Urinary Exosomal Biomarker for Diabetic Nephropathy Using Data-Independent Acquisition Proteomics. | No abstract available |
| 37702715 | One-Pot Analytical Pipeline for Efficient and Sensitive Proteomic Analysis of Extracellular Vesicles. | No abstract available |
| 38938674 | Gestational age at birth influences protein and RNA content in human milk extracellular vesicles. | No abstract available |
| 39290459 | Urinary extracellular vesicles as a monitoring tool for renal damage in patients not meeting criteria for chronic kidney disease. | No abstract available |
| 39443544 | Profiling of urinary extracellular vesicle protein signatures from patients with cribriform and intraductal prostate carcinoma in a cross-sectional study. | No abstract available |
| 40098346 | Toward Identification of Markers for Brain-Derived Extracellular Vesicles in Cerebrospinal Fluid: A Large-Scale, Unbiased Analysis Using Proximity Extension Assays. | No abstract available |
| 40311616 | Integrative proteomic profiling of tumor and plasma extracellular vesicles identifies a diagnostic biomarker panel for colorectal cancer. | No abstract available |