Protein detail
CD36
Platelet glycoprotein 4 (Fatty acid translocase) (FAT) (Glycoprotein IIIb) (GPIIIB) (Leukocyte differentiation antigen CD36) (PAS IV) (PAS-4) (Platelet collagen receptor) (Platelet glycoprotein IV) (GPIV) (Thrombospondin receptor) (CD antigen CD36)
Protein symbol CD36 | UniProt ID | EVMP score 0.25 |
Frequency 5 | Transmembrane count 2 | Protein classification Cancer-related genesCD markersDisease related genesHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
Basic Information
Protein Names
Platelet glycoprotein 4 (Fatty acid translocase) (FAT) (Glycoprotein IIIb) (GPIIIB) (Leukocyte differentiation antigen CD36) (PAS IV) (PAS-4) (Platelet collagen receptor) (Platelet glycoprotein IV) (GPIV) (Thrombospondin receptor) (CD antigen CD36)
Protein Class
Cancer-related genesCD markersDisease related genesHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function
- Human disease related genes:Cardiovascular diseases:Vascular diseases
- Transporters
- Predicted intracellular proteins
- Human disease related genes:Congenital disorders of metabolism:Other congenital disorders of metabolism
- CD markers
- Potential drug targets
- Cancer-related genes:Candidate cancer biomarkers
- Disease related genes
Transmembrane
8..29; Helical; 440..461; Helical
Transmembrane Count
2
Ensembl
Entrez Gene Symbol
Gene Synonym
FATGP3BGP4GPIVSCARB3
Gene Description
CD36 molecule
Chromosome
7
Position
80369575-80679277
Frequency
5
EVMP Score
0.25
Fluorescence & Localization
Tissue Specificbone marrowCell SpecificKupffer cells
Function & Pathway
Protein Function
- Human disease related genes:Cardiovascular diseases:Vascular diseases
- Transporters
- Predicted intracellular proteins
- Human disease related genes:Congenital disorders of metabolism:Other congenital disorders of metabolism
- CD markers
- Potential drug targets
- Cancer-related genes:Candidate cancer biomarkers
- Disease related genes
Cellular Component
- GO:0005615 extracellular space
- GO:0005794 Golgi apparatus
- GO:0005886 plasma membrane
- GO:0005901 caveola
- GO:0009897 external side of plasma membrane
- GO:0009986 cell surface
- GO:0016020 membrane
- GO:0016324 apical plasma membrane
- GO:0030666 endocytic vesicle membrane
- GO:0031092 platelet alpha granule membrane
- GO:0031526 brush border membrane
- GO:0035579 specific granule membrane
- GO:0043235 receptor complex
- GO:0045121 membrane raft
- GO:0045335 phagocytic vesicle
- GO:0071944 cell periphery
Molecular Function
- GO:0001540 amyloid-beta binding
- GO:0005041 low-density lipoprotein particle receptor activity
- GO:0005044 scavenger receptor activity
- GO:0005324 long-chain fatty acid transmembrane transporter activity
- GO:0005515 protein binding
- GO:0008035 high-density lipoprotein particle binding
- GO:0008289 lipid binding
- GO:0015636 short-chain fatty acid transmembrane transporter activity
- GO:0030169 low-density lipoprotein particle binding
- GO:0035325 Toll-like receptor binding
- GO:0038024 cargo receptor activity
- GO:0044877 protein-containing complex binding
- GO:0050431 transforming growth factor beta binding
- GO:0070053 thrombospondin receptor activity
- GO:0070892 lipoteichoic acid immune receptor activity
- GO:0071813 lipoprotein particle binding
- GO:0150025 oxidised low-density lipoprotein particle receptor activity
- GO:1901480 oleate transmembrane transporter activity
Biological Process
KEGG
- hsa03320 PPAR signaling pathway
- KEGG:hsa04145 Phagosome
- KEGG:hsa04148 Efferocytosis
- KEGG:hsa04152 AMPK signaling pathway
- KEGG:hsa04512 ECM-receptor interaction
- KEGG:hsa04640 Hematopoietic cell lineage
- KEGG:hsa04920 Adipocytokine signaling pathway
- KEGG:hsa04931 Insulin resistance
- KEGG:hsa04975 Fat digestion and absorption
- KEGG:hsa04979 Cholesterol metabolism
- KEGG:hsa05144 Malaria
- KEGG:hsa05415 Diabetic cardiomyopathy
- KEGG:hsa05417 Lipid and atherosclerosis
Reactome
- R-hsa-1280218 adaptive immune system
- R-hsa-9843745 adipogenesis
- R-hsa-1236975 antigen processing cross presentation
- R-hsa-2173782 binding and uptake of ligands by scavenger receptors
- R-hsa-983169 class i mhc mediated antigen processing presentation
- R-hsa-1236973 cross presentation of particulate exogenous antigens phagosomes
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-5260271 diseases of immune system
- R-hsa-9917777 epigenetic regulation by wdr5 containing histone modifying complexes
- R-hsa-212165 epigenetic regulation of gene expression
- R-hsa-9818564 epigenetic regulation of gene expression by mll3 and mll4 complexes
- R-hsa-400451 free fatty acids regulate insulin secretion
- R-hsa-109582 hemostasis
- R-hsa-168249 innate immune system
- R-hsa-163685 integration of energy metabolism
- R-hsa-6785807 interleukin 4 and interleukin 13 signaling
- R-hsa-5603041 irak4 deficiency tlr2 4
- R-hsa-556833 metabolism of lipids
- R-hsa-6798695 neutrophil degranulation
- R-hsa-76002 platelet activation signaling and aggregation
- R-hsa-422356 regulation of insulin secretion
- R-hsa-400206 regulation of lipid metabolism by pparalpha
- R-hsa-5686938 regulation of tlr by endogenous ligand
- R-hsa-76005 response to elevated platelet cytosolic ca2
- R-hsa-3000471 scavenging by class b receptors
- R-hsa-449147 signaling by interleukins
- R-hsa-168898 toll like receptor cascades
- R-hsa-168179 toll like receptor tlr1 tlr2 cascade
- R-hsa-381340 transcriptional regulation of white adipocyte differentiation
- R-hsa-5653656 vesicle mediated transport
Canonical Pathways
- M233 Pid epo pathway
- M1315 Sig pip3 signaling in b lymphocytes
- M94 Pid fas pathway
Mediation Categories
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
1 record.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| CD36 | PRKCA | P17252 | T | 92 | phosphorylation | RLIMS-P_ProtMapperPhosphoSitePhosphoSite_ProtMapperProtMapper | ProtMapper:22247259 |
Ligand-Receptor Signaling
62 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | CellPhoneDB | No | Yes | No | Yes | No |
| receptor | receptor | GO_Intercell | No | Yes | No | Yes | No |
| receptor | receptor | HPMR | No | Yes | No | Yes | No |
| receptor | receptor | ICELLNET | No | Yes | No | Yes | No |
| receptor | receptor | CellChatDB | No | Yes | No | Yes | No |
| receptor | receptor | CellTalkDB | No | Yes | No | Yes | No |
| receptor | receptor | Surfaceome | No | Yes | No | Yes | No |
| receptor | receptor | Ramilowski2015 | No | Yes | No | Yes | No |
| receptor | receptor | Guide2Pharma | No | Yes | No | Yes | No |
| receptor | receptor | LRdb | No | Yes | No | Yes | No |
Page 1 of 7Next
Regulatory Interaction Network
2 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| ARBK1 | P25098 | CD36 | P16671 | Yes | No | Yes | SIGNOR | SIGNOR:30171848 |
| KPCA | P17252 | CD36 | P16671 | Yes | No | No | iPTMnetProtMapperRLIMS-P_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:22247259PhosphoSite:22247259 |
Protein Complex Composition
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Western blottingImmunofluorescence | 1 | 37651725 |
Sequence, Structure & Domains
Sequences
Length
472
Mass
53,053
Sequence
MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=P16671-1; Sequence=Displayed; Name=2; Synonyms=ex8-del; IsoId=P16671-2; Sequence=VSP_055978, VSP_055979; Name=3; Synonyms=ex6-7-del; IsoId=P16671-3; Sequence=VSP_055977; Name=4; Synonyms=ex4-del; IsoId=P16671-4; Sequence=VSP_055976
Alternative Sequence
144..203; Missing (in isoform 4); 234..272; Missing (in isoform 3); 274..288; SIYAVFESDVNLKGI -> ETCVHFTSSFSVCKS (in isoform 2); 289..472; Missing (in isoform 2)
3D Structural Models
Turn
107..110; 269..272; 303..305; 317..323; 334..336; 375..377
Helix
38..41; 49..55; 73..79; 124..126; 140..148; 152..164; 175..180; 187..189; 221..223; 241..244; 297..300; 307..312; 331..333; 344..346; 351..354; 364..367; 400..402; 424..433
Beta Strand
42..45; 61..71; 83..96; 101..106; 111..117; 120..122; 127..129; 134..138; 169..174; 208..215; 227..230; 233..235; 237..240; 251..253; 263..268; 273..285; 288..294; 326..329; 339..342; 357..359; 370..373; 379..393; 409..421
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Region
93..120; Required for interaction with thrombospondins, THBS1 and THBS2; 460..472; Interaction with PTK2, PXN and LYN
Protein Families
CD36 family
Sequence Similarities
Belongs to the CD36 family.