Protein detail
CD36
Platelet glycoprotein 4 (Fatty acid translocase) (FAT) (Glycoprotein IIIb) (GPIIIB) (Leukocyte differentiation antigen CD36) (PAS IV) (PAS-4) (Platelet collagen receptor) (Platelet glycoprotein IV) (GPIV) (Thrombospondin receptor) (CD antigen CD36)
Entry name CD36 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 5 | Transmembrane count 2 | Protein classification Cancer-related genesCD markersDisease related genesHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Platelet glycoprotein 4 (Fatty acid translocase) (FAT) (Glycoprotein IIIb) (GPIIIB) (Leukocyte differentiation antigen CD36) (PAS IV) (PAS-4) (Platelet collagen receptor) (Platelet glycoprotein IV) (GPIV) (Thrombospondin receptor) (CD antigen CD36)
Protein Class (10)
Cancer-related genesCD markersDisease related genesHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function (8)
- Human disease related genes:Cardiovascular diseases:Vascular diseases
- Transporters
- Predicted intracellular proteins
- Human disease related genes:Congenital disorders of metabolism:Other congenital disorders of metabolism
- CD markers
- Potential drug targets
- Cancer-related genes:Candidate cancer biomarkers
- Disease related genes
Transmembrane
8..29; Helical; 440..461; Helical
Transmembrane Count
2
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
FATGP3BGP4GPIVSCARB3
Gene Description
CD36 molecule
Chromosome
7
Position
80369575-80679277
Supporting publications (n)
5
EVMP confidence score
0.53
Fluorescence & Localization
Tissue Specificbone marrowCell SpecificKupffer cells
Function & Pathway
Protein Function (8)
- Human disease related genes:Cardiovascular diseases:Vascular diseases
- Transporters
- Predicted intracellular proteins
- Human disease related genes:Congenital disorders of metabolism:Other congenital disorders of metabolism
- CD markers
- Potential drug targets
- Cancer-related genes:Candidate cancer biomarkers
- Disease related genes
Cellular Component (16)
- GO:0005615 extracellular space
- GO:0005794 Golgi apparatus
- GO:0005886 plasma membrane
- GO:0005901 caveola
- GO:0009897 external side of plasma membrane
- GO:0009986 cell surface
- GO:0016020 membrane
- GO:0016324 apical plasma membrane
- GO:0030666 endocytic vesicle membrane
- GO:0031092 platelet alpha granule membrane
Page 1 of 2
Molecular Function (18)
- GO:0001540 amyloid-beta binding
- GO:0005041 low-density lipoprotein particle receptor activity
- GO:0005044 scavenger receptor activity
- GO:0005324 long-chain fatty acid transmembrane transporter activity
- GO:0005515 protein binding
- GO:0008035 high-density lipoprotein particle binding
- GO:0008289 lipid binding
- GO:0015636 short-chain fatty acid transmembrane transporter activity
- GO:0030169 low-density lipoprotein particle binding
- GO:0035325 Toll-like receptor binding
Page 1 of 2
Biological Process (3)
KEGG (13)
- hsa03320 PPAR signaling pathway
- KEGG:hsa04145 Phagosome
- KEGG:hsa04148 Efferocytosis
- KEGG:hsa04152 AMPK signaling pathway
- KEGG:hsa04512 ECM-receptor interaction
- KEGG:hsa04640 Hematopoietic cell lineage
- KEGG:hsa04920 Adipocytokine signaling pathway
- KEGG:hsa04931 Insulin resistance
- KEGG:hsa04975 Fat digestion and absorption
- KEGG:hsa04979 Cholesterol metabolism
Page 1 of 2
Reactome (30)
- R-hsa-1280218 adaptive immune system
- R-hsa-9843745 adipogenesis
- R-hsa-1236975 antigen processing cross presentation
- R-hsa-2173782 binding and uptake of ligands by scavenger receptors
- R-hsa-983169 class i mhc mediated antigen processing presentation
- R-hsa-1236973 cross presentation of particulate exogenous antigens phagosomes
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-5260271 diseases of immune system
- R-hsa-9917777 epigenetic regulation by wdr5 containing histone modifying complexes
- R-hsa-212165 epigenetic regulation of gene expression
Page 1 of 3
Canonical Pathways (3)
- M233 Pid epo pathway
- M1315 Sig pip3 signaling in b lymphocytes
- M94 Pid fas pathway
Mediation Categories (6)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence67
Enzyme-Mediated Modification (1)
1 record.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| CD36 | PRKCA | P17252 | T | 92 | phosphorylation | RLIMS-P_ProtMapperPhosphoSitePhosphoSite_ProtMapperProtMapper | ProtMapper:22247259 |
Ligand-Receptor Signaling (62)
62 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| extracellular | extracellular | DGIdb | Yes | ||||
| extracellular | extracellular | OmniPath | Yes | ||||
| intracellular | intracellular | ComPPI | Yes | ||||
| intracellular | intracellular | GO_Intercell | Yes | ||||
| intracellular | intracellular | UniProt_location | Yes | ||||
| intracellular | intracellular | OmniPath | Yes | ||||
| growth_factor_binder | ligand_regulator | GO_Intercell | Yes | Yes | |||
| ligand_regulator | ligand_regulator | OmniPath | Yes | Yes | |||
| adhesion | adhesion | MCAM | Yes | Yes | Yes | ||
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | Yes |
Regulatory Interaction Network (2)
2 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| ARBK1 | P25098 | CD36 | P16671 | Yes | Yes | SIGNOR | SIGNOR:30171848 | |
| KPCA | P17252 | CD36 | P16671 | Yes | iPTMnetProtMapperRLIMS-P_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:22247259PhosphoSite:22247259 |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Western blottingImmunofluorescence | 1 | 37651725 |
Sequence, Structure & Domains
Sequences
Length
472
Mass
53,053
Sequence
MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=P16671-1; Sequence=Displayed; Name=2; Synonyms=ex8-del; IsoId=P16671-2; Sequence=VSP_055978, VSP_055979; Name=3; Synonyms=ex6-7-del; IsoId=P16671-3; Sequence=VSP_055977; Name=4; Synonyms=ex4-del; IsoId=P16671-4; Sequence=VSP_055976
Alternative Sequence
144..203; Missing (in isoform 4); 234..272; Missing (in isoform 3); 274..288; SIYAVFESDVNLKGI -> ETCVHFTSSFSVCKS (in isoform 2); 289..472; Missing (in isoform 2)
3D Structural Models
Turn
107..110; 269..272; 303..305; 317..323; 334..336; 375..377
Helix
38..41; 49..55; 73..79; 124..126; 140..148; 152..164; 175..180; 187..189; 221..223; 241..244; 297..300; 307..312; 331..333; 344..346; 351..354; 364..367; 400..402; 424..433
Beta Strand
42..45; 61..71; 83..96; 101..106; 111..117; 120..122; 127..129; 134..138; 169..174; 208..215; 227..230; 233..235; 237..240; 251..253; 263..268; 273..285; 288..294; 326..329; 339..342; 357..359; 370..373; 379..393; 409..421
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Region
93..120; Required for interaction with thrombospondins, THBS1 and THBS2; 460..472; Interaction with PTK2, PXN and LYN
Protein Families
CD36 family
Sequence Similarities
Belongs to the CD36 family.
Clinical Relevance
Supporting Publications5
| PMID | Title | Related sentences |
|---|---|---|
| 22620679 | Bronchoalveolar lavage fluid exosomes contribute to cytokine and leukotriene production in allergic asthma. | RESULTS: Compared to BALF exosomes from healthy individuals, BALF exosomes from asthmatics displayed higher levels of exosome-associated markers, such as the tetraspanins CD63 and CD81 and the scavenger receptor CD36. |
| 37419919 | Endothelial cell CD36 regulates membrane ceramide formation, exosome fatty acid transfer and circulating fatty acid levels. | Endothelial cell CD36 regulates membrane ceramide formation, exosome fatty acid transfer and circulating fatty acid levels. |
| 38926392 | Macrophage-derived CD36 + exosome subpopulations as novel biomarkers of Candida albicans infection. | Additionally, the CD36exosome subpopulations, identified through our analysis, could serve as potential biomarkers and therapeutic targets for C. albicans infection. In our study, we analyzed differentially expressed proteins in exosomes from macrophages and C. albicans -infected macrophages, focusing on proteins such as ACE2, CD36, CAV1, LAMP2, CD27, and MPO. We also examined exosome subpopulations, finding a dominant expression of MPO in the most prevalent subgroup, and a distinct expression of CD36 in cluster14. |
| 38963761 | Lipid-associated macrophages reshape BAT cell identity in obesity. | LAMs participate in this scenario by capturing extracellular vesicles carrying damaged lipids and mitochondria released from metabolically stressed brown adipocytes. |
| 39062552 | Melanoma-Derived Extracellular Vesicles Induce CD36-Mediated Pre-Metastatic Niche. | Extracellular vesicles (EVs) secreted by malignant melanocytes play a vital role in developing tumor-promoting microenvironments, but it is unclear whether this is mediated through CD36. Melanoma-Derived Extracellular Vesicles Induce CD36-Mediated Pre-Metastatic Niche. |