Protein detail

CD36

Platelet glycoprotein 4 (Fatty acid translocase) (FAT) (Glycoprotein IIIb) (GPIIIB) (Leukocyte differentiation antigen CD36) (PAS IV) (PAS-4) (Platelet collagen receptor) (Platelet glycoprotein IV) (GPIV) (Thrombospondin receptor) (CD antigen CD36)

Entry name
CD36
UniProt ID
EVMP confidence score
0.53
Supporting publications (n)
5
Transmembrane count
2
Protein classification
Cancer-related genesCD markersDisease related genesHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Basic Information
Protein Names
Platelet glycoprotein 4 (Fatty acid translocase) (FAT) (Glycoprotein IIIb) (GPIIIB) (Leukocyte differentiation antigen CD36) (PAS IV) (PAS-4) (Platelet collagen receptor) (Platelet glycoprotein IV) (GPIV) (Thrombospondin receptor) (CD antigen CD36)
Protein Class (10)
Cancer-related genesCD markersDisease related genesHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function (8)
  • Human disease related genes:Cardiovascular diseases:Vascular diseases
  • Transporters
  • Predicted intracellular proteins
  • Human disease related genes:Congenital disorders of metabolism:Other congenital disorders of metabolism
  • CD markers
  • Potential drug targets
  • Cancer-related genes:Candidate cancer biomarkers
  • Disease related genes
Transmembrane
8..29; Helical; 440..461; Helical
Transmembrane Count
2
Entrez Gene Symbol
Gene Synonym (5)
FATGP3BGP4GPIVSCARB3
Gene Description
CD36 molecule
Chromosome
7
Position
80369575-80679277
Supporting publications (n)
5
EVMP confidence score
0.53
Fluorescence & Localization
CD36 fluorescence
Tissue Specificbone marrowCell SpecificKupffer cells
Function & Pathway
Protein Function (8)
  • Human disease related genes:Cardiovascular diseases:Vascular diseases
  • Transporters
  • Predicted intracellular proteins
  • Human disease related genes:Congenital disorders of metabolism:Other congenital disorders of metabolism
  • CD markers
  • Potential drug targets
  • Cancer-related genes:Candidate cancer biomarkers
  • Disease related genes
Canonical Pathways (3)
  • M233 Pid epo pathway
  • M1315 Sig pip3 signaling in b lymphocytes
  • M94 Pid fas pathway
Mediation Categories (6)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence67

Enzyme-Mediated Modification (1)

1 record.

Substrate Gene SymbolEnzyme Gene SymbolEnzyme UniProt IDResidue TypeResidue OffsetModificationDatabaseReferences
CD36PRKCAP17252T92phosphorylationRLIMS-P_ProtMapperPhosphoSitePhosphoSite_ProtMapperProtMapperProtMapper:22247259

Ligand-Receptor Signaling (62)

62 records.

CategoryParentDatabaseTransmitterReceiverSecretedPlasma Membrane (Transmembrane)Plasma Membrane (Peripheral)
receptorreceptorHGNCYesYes
transmembranetransmembrane_predictedPhobiusYes
Page 7 of 7Previous

Regulatory Interaction Network (2)

2 records.

Source Protein SymbolSource UniProt IDTarget Protein SymbolTarget UniProt IDIs DirectedIs StimulationIs InhibitionDatabaseReferences
ARBK1P25098CD36P16671YesYesSIGNORSIGNOR:30171848
KPCAP17252CD36P16671YesiPTMnetProtMapperRLIMS-P_ProtMapperPhosphoSitePhosphoSite_ProtMapperProtMapper:22247259PhosphoSite:22247259

Protein Complex Composition (1)

1 record.

Component NameComponent Gene SymbolsComponent UniProt IDStoichiometryDatabaseDatabase IDsReferences
CD36CROTUSP25P16671Q9UHP3Q9UKG90:0:0hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation MethodDetection MethodNumber of ReferencesReferences
Differential UltracentrifugationSize Exclusion ChromatographyWestern blottingImmunofluorescence137651725
Sequence, Structure & Domains

Sequences

Length
472
Mass
53,053
Sequence
MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=P16671-1; Sequence=Displayed; Name=2; Synonyms=ex8-del; IsoId=P16671-2; Sequence=VSP_055978, VSP_055979; Name=3; Synonyms=ex6-7-del; IsoId=P16671-3; Sequence=VSP_055977; Name=4; Synonyms=ex4-del; IsoId=P16671-4; Sequence=VSP_055976
Alternative Sequence
144..203; Missing (in isoform 4); 234..272; Missing (in isoform 3); 274..288; SIYAVFESDVNLKGI -> ETCVHFTSSFSVCKS (in isoform 2); 289..472; Missing (in isoform 2)

3D Structural Models

Turn
107..110; 269..272; 303..305; 317..323; 334..336; 375..377
Helix
38..41; 49..55; 73..79; 124..126; 140..148; 152..164; 175..180; 187..189; 221..223; 241..244; 297..300; 307..312; 331..333; 344..346; 351..354; 364..367; 400..402; 424..433
Beta Strand
42..45; 61..71; 83..96; 101..106; 111..117; 120..122; 127..129; 134..138; 169..174; 208..215; 227..230; 233..235; 237..240; 251..253; 263..268; 273..285; 288..294; 326..329; 339..342; 357..359; 370..373; 379..393; 409..421
3D Structure
X-ray crystallography (1)

Domain & Motif Annotations

Region
93..120; Required for interaction with thrombospondins, THBS1 and THBS2; 460..472; Interaction with PTK2, PXN and LYN
Protein Families
CD36 family
Sequence Similarities
Belongs to the CD36 family.
Clinical Relevance
Disease Involvement (2)
Cancer-related genesDisease variant
Drugs
Supporting Publications5
PMIDTitleRelated sentences
22620679Bronchoalveolar lavage fluid exosomes contribute to cytokine and leukotriene production in allergic asthma.RESULTS: Compared to BALF exosomes from healthy individuals, BALF exosomes from asthmatics displayed higher levels of exosome-associated markers, such as the tetraspanins CD63 and CD81 and the scavenger receptor CD36.
37419919Endothelial cell CD36 regulates membrane ceramide formation, exosome fatty acid transfer and circulating fatty acid levels.Endothelial cell CD36 regulates membrane ceramide formation, exosome fatty acid transfer and circulating fatty acid levels.
38926392Macrophage-derived CD36 + exosome subpopulations as novel biomarkers of Candida albicans infection.Additionally, the CD36exosome subpopulations, identified through our analysis, could serve as potential biomarkers and therapeutic targets for C. albicans infection. In our study, we analyzed differentially expressed proteins in exosomes from macrophages and C. albicans -infected macrophages, focusing on proteins such as ACE2, CD36, CAV1, LAMP2, CD27, and MPO. We also examined exosome subpopulations, finding a dominant expression of MPO in the most prevalent subgroup, and a distinct expression of CD36 in cluster14.
38963761Lipid-associated macrophages reshape BAT cell identity in obesity.LAMs participate in this scenario by capturing extracellular vesicles carrying damaged lipids and mitochondria released from metabolically stressed brown adipocytes.
39062552Melanoma-Derived Extracellular Vesicles Induce CD36-Mediated Pre-Metastatic Niche.Extracellular vesicles (EVs) secreted by malignant melanocytes play a vital role in developing tumor-promoting microenvironments, but it is unclear whether this is mediated through CD36. Melanoma-Derived Extracellular Vesicles Induce CD36-Mediated Pre-Metastatic Niche.