Protein detail
KPCA
Protein kinase C alpha type (PKC-A) (PKC-alpha) (EC 2.7.11.13)
Entry name KPCA | UniProt ID | EVMP score 0.38 |
Frequency 5 | Transmembrane count | Protein classification Cancer-related genesEnzymesFDA approved drug targetsPlasma proteinsPredicted intracellular proteinsRAS pathway related proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Protein kinase C alpha type (PKC-A) (PKC-alpha) (EC 2.7.11.13)
Protein Class
Cancer-related genesEnzymesFDA approved drug targetsPlasma proteinsPredicted intracellular proteinsRAS pathway related proteins
Protein Function
- Predicted intracellular proteins
- ENZYME proteins:Transferases
- RAS pathway related proteins
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
- Kinases:AGC Ser/Thr protein kinases
- FDA approved drug targets:Small molecule drugs
Ensembl
Entrez Gene Symbol
Gene Synonym
PKCAPKCalpha
Gene Description
Protein kinase C alpha
Chromosome
17
Position
66302613-66810743
Frequency
5
EVMP Score
0.38
Fluorescence & Localization
Cell SpecificAstrocytesSingle-Nuclei Brain Specificastrocyte
Function & Pathway
Protein Function
- Predicted intracellular proteins
- ENZYME proteins:Transferases
- RAS pathway related proteins
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
- Kinases:AGC Ser/Thr protein kinases
- FDA approved drug targets:Small molecule drugs
Cellular Component
- GO:0005654 nucleoplasm
- GO:0005737 cytoplasm
- GO:0005739 mitochondrion
- GO:0005783 endoplasmic reticulum
- GO:0005829 cytosol
- GO:0005886 plasma membrane
- GO:0031966 mitochondrial membrane
- GO:0035866 alphav-beta3 integrin-PKCalpha complex
- GO:0036064 ciliary basal body
- GO:0048471 perinuclear region of cytoplasm
- GO:0070062 extracellular exosome
Molecular Function
- GO:0004672 protein kinase activity
- GO:0004674 protein serine/threonine kinase activity
- GO:0004697 diacylglycerol-dependent serine/threonine kinase activity
- GO:0004698 calcium,diacylglycerol-dependent serine/threonine kinase activity
- GO:0005178 integrin binding
- GO:0005515 protein binding
- GO:0005524 ATP binding
- GO:0008270 zinc ion binding
- GO:0019899 enzyme binding
- GO:0019992 diacylglycerol binding
- GO:0035403 histone H3T6 kinase activity
- GO:0106310 protein serine kinase activity
KEGG
- hsa01521 EGFR tyrosine kinase inhibitor resistance
- KEGG:hsa04010 MAPK signaling pathway
- KEGG:hsa04012 ErbB signaling pathway
- KEGG:hsa04014 Ras signaling pathway
- KEGG:hsa04015 Rap1 signaling pathway
- KEGG:hsa04020 Calcium signaling pathway
- KEGG:hsa04066 HIF-1 signaling pathway
- KEGG:hsa04070 Phosphatidylinositol signaling system
- KEGG:hsa04071 Sphingolipid signaling pathway
- KEGG:hsa04072 Phospholipase D signaling pathway
- KEGG:hsa04082 Neuroactive ligand signaling
- KEGG:hsa04150 mTOR signaling pathway
- KEGG:hsa04151 PI3K-Akt signaling pathway
- KEGG:hsa04261 Adrenergic signaling in cardiomyocytes
- KEGG:hsa04270 Vascular smooth muscle contraction
- KEGG:hsa04310 Wnt signaling pathway
- KEGG:hsa04360 Axon guidance
- KEGG:hsa04370 VEGF signaling pathway
- KEGG:hsa04510 Focal adhesion
- KEGG:hsa04517 IgSF CAM signaling
- KEGG:hsa04540 Gap junction
- KEGG:hsa04613 Neutrophil extracellular trap formation
- KEGG:hsa04650 Natural killer cell mediated cytotoxicity
- KEGG:hsa04664 Fc epsilon RI signaling pathway
- KEGG:hsa04666 Fc gamma R-mediated phagosome formation
- KEGG:hsa04670 Leukocyte transendothelial migration
- KEGG:hsa04713 Circadian entrainment
- KEGG:hsa04720 Long-term potentiation
- KEGG:hsa04723 Retrograde endocannabinoid signaling
- KEGG:hsa04724 Glutamatergic synapse
- KEGG:hsa04725 Cholinergic synapse
- KEGG:hsa04726 Serotonergic synapse
- KEGG:hsa04727 GABAergic synapse
- KEGG:hsa04728 Dopaminergic synapse
- KEGG:hsa04730 Long-term depression
- KEGG:hsa04750 Inflammatory mediator regulation of TRP channels
- KEGG:hsa04911 Insulin secretion
- KEGG:hsa04912 GnRH signaling pathway
- KEGG:hsa04916 Melanogenesis
- KEGG:hsa04918 Thyroid hormone synthesis
- KEGG:hsa04919 Thyroid hormone signaling pathway
- KEGG:hsa04921 Oxytocin signaling pathway
- KEGG:hsa04925 Aldosterone synthesis and secretion
- KEGG:hsa04926 Relaxin signaling pathway
- KEGG:hsa04928 Parathyroid hormone synthesis, secretion and action
- KEGG:hsa04929 GnRH secretion
- KEGG:hsa04933 AGE-RAGE signaling pathway in diabetic complications
- KEGG:hsa04935 Growth hormone synthesis, secretion and action
- KEGG:hsa04960 Aldosterone-regulated sodium reabsorption
- KEGG:hsa04961 Endocrine and other factor-regulated calcium reabsorption
- KEGG:hsa04970 Salivary secretion
- KEGG:hsa04971 Gastric acid secretion
- KEGG:hsa04972 Pancreatic secretion
- KEGG:hsa05017 Spinocerebellar ataxia
- KEGG:hsa05022 Pathways of neurodegeneration - multiple diseases
- KEGG:hsa05031 Amphetamine addiction
- KEGG:hsa05032 Morphine addiction
- KEGG:hsa05110 Vibrio cholerae infection
- KEGG:hsa05143 African trypanosomiasis
- KEGG:hsa05146 Amoebiasis
- KEGG:hsa05161 Hepatitis B
- KEGG:hsa05163 Human cytomegalovirus infection
- KEGG:hsa05164 Influenza A
- KEGG:hsa05170 Human immunodeficiency virus 1 infection
- KEGG:hsa05171 Coronavirus disease
- KEGG:hsa05200 Pathways in cancer
- KEGG:hsa05205 Proteoglycans in cancer
- KEGG:hsa05206 MicroRNAs in cancer
- KEGG:hsa05207 Chemical carcinogenesis - receptor activation
- KEGG:hsa05214 Glioma
- KEGG:hsa05223 Non-small cell lung cancer
- KEGG:hsa05225 Hepatocellular carcinoma
- KEGG:hsa05231 Choline metabolism in cancer
- KEGG:hsa05415 Diabetic cardiomyopathy
- KEGG:hsa05417 Lipid and atherosclerosis
Reactome
- R-hsa-399997 acetylcholine regulates insulin secretion
- R-hsa-3858494 beta catenin independent wnt signaling
- R-hsa-4086398 ca2 pathway
- R-hsa-111996 ca dependent events
- R-hsa-1640170 cell cycle
- R-hsa-69278 cell cycle mitotic
- R-hsa-1489509 dag and ip3 signaling
- R-hsa-4419969 depolymerization of the nuclear lamina
- R-hsa-114516 disinhibition of snare formation
- R-hsa-2179392 egfr transactivation by gastrin
- R-hsa-1474244 extracellular matrix organization
- R-hsa-881907 gastrin creb signalling pathway via pkc and mapk
- R-hsa-418594 g alpha i signalling events
- R-hsa-416476 g alpha q signalling events
- R-hsa-418597 g alpha z signalling events
- R-hsa-112040 g protein mediated events
- R-hsa-109582 hemostasis
- R-hsa-450520 hur elavl1 binds and stabilizes mrna
- R-hsa-163685 integration of energy metabolism
- R-hsa-9006925 intracellular signaling by second messengers
- R-hsa-8953854 metabolism of rna
- R-hsa-68875 mitotic prophase
- R-hsa-68886 m phase
- R-hsa-9675108 nervous system development
- R-hsa-112316 neuronal system
- R-hsa-112314 neurotransmitter receptors and postsynaptic signal transmission
- R-hsa-3000171 non integrin membrane ecm interactions
- R-hsa-2980766 nuclear envelope breakdown
- R-hsa-111885 opioid signalling
- R-hsa-4086400 pcp ce pathway
- R-hsa-76002 platelet activation signaling and aggregation
- R-hsa-422356 regulation of insulin secretion
- R-hsa-1433559 regulation of kit signaling
- R-hsa-450531 regulation of mrna stability by proteins that bind au rich elements
- R-hsa-76005 response to elevated platelet cytosolic ca2
- R-hsa-8853659 ret signaling
- R-hsa-5668599 rho gtpases activate nadph oxidases
- R-hsa-195258 rho gtpase effectors
- R-hsa-9010642 robo receptors bind akap5
- R-hsa-9709957 sensory perception
- R-hsa-1250196 shc1 events in erbb2 signaling
- R-hsa-1227986 signaling by erbb2
- R-hsa-372790 signaling by gpcr
- R-hsa-9006934 signaling by receptor tyrosine kinases
- R-hsa-9716542 signaling by rho gtpases miro gtpases and rhobtb3
- R-hsa-376176 signaling by robo receptors
- R-hsa-1433557 signaling by scf kit
- R-hsa-194138 signaling by vegf
- R-hsa-195721 signaling by wnt
- R-hsa-3000170 syndecan interactions
- R-hsa-2514856 the phototransduction cascade
- R-hsa-399719 trafficking of ampa receptors
- R-hsa-416993 trafficking of glur2 containing ampa receptors
- R-hsa-112315 transmission across chemical synapses
- R-hsa-5218921 vegfr2 mediated cell proliferation
- R-hsa-2187338 visual phototransduction
- R-hsa-5099900 wnt5a dependent internalization of fzd4
Mediation Categories
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
18 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| PRKCA | SYK | P43405 | Y | 658 | phosphorylation | Sparser_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEAphosphoELMSIGNOR_ProtMapper | ProtMapper:12881490HPRD:12881490KEA:12881490HPRD:20068231SIGNOR:12881490KEA:17192257phosphoELM:12881490 |
| PRKCA | PHLPP2 | Q6ZVD8 | S | 657 | dephosphorylation | SIGNORDEPOD | SIGNOR:18162466DEPOD:18162466 |
| PRKCA | PHLPP2 | Q6ZVD8 | S | 657 | phosphorylation | SIGNOR_ProtMapperProtMapper | ProtMapper:18162466 |
| PRKCA | PHLPP1 | O60346 | S | 657 | dephosphorylation | SIGNORDEPOD | SIGNOR:18162466DEPOD:18162466 |
| PRKCA | PHLPP1 | O60346 | S | 657 | phosphorylation | SIGNOR_ProtMapperProtMapper | ProtMapper:18162466 |
| PRKCA | PRKCZ | Q05513 | S | 657 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPHPRDKEA | HPRD:12162751HPRD:10339425HPRD:20068231KEA:8856079KEA:12162751HPRD:18691976KEA:10339425HPRD:8856079 |
| PRKCA | STK3 | Q13188 | S | 226 | phosphorylation | Sparser_ProtMapperProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:26414765 |
| PRKCA | STK3 | Q13188 | T | 228 | phosphorylation | Sparser_ProtMapperProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:26414765 |
| PRKCA | MST1 | P26927 | S | 226 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:26414765 |
| PRKCA | MST1 | P26927 | T | 228 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:26414765 |
Page 1 of 2Next
Ligand-Receptor Signaling
10 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | SignaLink_function | No | Yes | No | No | No |
| receptor | receptor | OmniPath | No | Yes | No | No | No |
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
| receptor | receptor | scConnect | No | Yes | No | No | No |
Regulatory Interaction Network
311 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KPCA | P17252 | PI2R | P43119 | Yes | No | No | PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAphosphoELM_KEAHPRD_KEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:9722557phosphoELM:9722557PhosphoSite:12016224KEA:9722557HPRD:9722557SIGNOR:9722557PhosphoSite:9722557 |
| KPCA | P17252 | PEA15 | Q15121 | Yes | No | Yes | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperHPRD-phos | ProtMapper:15917297HPRD:9721757HPRD-phos:9721757HPRD-phos:17287340ProtMapper:19651622ProtMapper:20068231HPRD-phos:20068231SIGNOR:15917297ProtMapper:17287340KEA:9721757ProtMapper:9721757HPRD-phos:19651622 |
| KPCA | P17252 | TACD2 | P09758 | Yes | No | Yes | PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperPhosphoSite_KEAKEAphosphoELM_KEAphosphoELMPhosphoSitePhosphoSite_ProtMapper | KEA:7635574phosphoELM:7635574SIGNOR:31177095PhosphoSite:31177095PhosphoSite:25981199PhosphoSite:7635574 |
| KPCA | P17252 | EDF1 | O60869 | Yes | No | Yes | MIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperHPRD-phos | SIGNOR:10816571ProtMapper:10816571HPRD:10816571KEA:10816571HPRD-phos:10816571 |
| KPCA | P17252 | ITB4 | P16144 | Yes | Yes | Yes | SIGNORProtMapperPhosphoSite_KEAphosphoELM_KEAHPRDCancerCellMapWangPhosphoSite_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPPhosphoSite_norefPhosphoPointiPTMnetKEAphosphoELMSIGNOR_ProtMapperPhosphoSiteAdhesome | PhosphoSite:20870721PhosphoSite:22824799HPRD:12919677PhosphoSite:17615294HPRD:15121854KEA:15121854CancerCellMap:15121854phosphoELM:15121854Adhesome:15121854Adhesome:10592173SIGNOR:15121854HPRD:10477766ProtMapper:15121854Adhesome:10477766Adhesome:12919677PhosphoSite:19005215PhosphoSite:15121854CancerCellMap:12919677CancerCellMap:10477766 |
| KPCA | P17252 | P73 | O15350 | Yes | Yes | No | PhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:19158275SIGNOR:19158275 |
| KPCA | P17252 | GFPT1 | Q06210 | Yes | No | Yes | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapper | KEA:9836513HPRD:10806197ProtMapper:10806197SIGNOR:10806197KEA:10806197 |
| KPCA | P17252 | IF4G1 | Q04637 | Yes | Yes | No | Sparser_ProtMapperPhosphoSite_norefSIGNORiPTMnetProtMapperREACH_ProtMapperPhosphoSite_ProtMapper | ProtMapper:29438499SIGNOR:21576361 |
| KPCA | P17252 | CY24A | P13498 | Yes | Yes | No | PhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetSIGNORProtMapperSIGNOR_ProtMapperPhosphoSite_ProtMapper | ProtMapper:19948736SIGNOR:19948736 |
| KPCA | P17252 | CFLAR | O15519 | Yes | Yes | No | PhosphoSite_MIMPMIMPPhosphoSite_norefSIGNORiPTMnetProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:19343040PhosphoSite:19343040 |
Protein Complex Composition
7 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| PRKCAPRKCBPRKCGPRKCH | C0HM02P05129P05771P17252 | 0:0:0:0 | hu.MAP2 | |||
| PRKCAPRKCBPRKCGPRKCH | P05129P05771P17252P24723 | 0:0:0:0 | hu.MAP2 | |||
| GRIA4PICK1PRKCAPRKCG | P05129P17252P48058Q9NRD5 | 1:1:1:1 | CompleatCFinder | Compleat:HC8969 | ||
| CDK1HSPA4NCF1PRKCAPRKCBTOP2A | P05771P06493P11388P14598P17252P34932 | 1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC7043 | ||
| PRKCA | P17252 | 3 | PDB | PDB:3iw4 | ||
| ATP6V1B2H4C4HMGCS1IGBP1JMJD6MLST8MORF4L1NRGNPRKCASCPEP1 | P17252P21281P62805P78318Q01581Q6NYC1Q92686Q9BVC4Q9HB40Q9UBU8 | 1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC3946 | ||
| CBX8NCAPHPCGF2PHC2PRKCATOP2B | P17252P35227Q02880Q15003Q8IXK0Q9HC52 | 1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC4640 |
Sequence, Structure & Domains
Sequences
Length
672
Mass
76,750
Sequence
MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNMELRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSVCKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV
3D Structural Models
Turn
98..100; 141..146
Helix
233..237; 263..268; 282..284; 336..338; 372..378; 381..392; 425..430; 437..456; 466..468; 502..504; 507..510; 518..533; 543..552; 563..572; 577..579; 587..592; 595..597; 602..606; 642..645; 650..653
Beta Strand
105..107; 116..118; 125..127; 129..131; 133..135; 138..140; 161..169; 172..182; 194..202; 222..230; 239..246; 249..251; 254..262; 271..276; 339..348; 351..358; 364..371; 403..408; 410..418; 422..424; 469..471; 477..479
3D Structure
NMR spectroscopy (1); X-ray crystallography (5)
Domain & Motif Annotations
Zinc Finger
36..86; Phorbol-ester/DAG-type 1; 101..151; Phorbol-ester/DAG-type 2
Domain (FT)
158..275; C2; 339..597; Protein kinase; 598..668; AGC-kinase C-terminal
Protein Families
- Protein kinase superfamily
- AGC Ser/Thr protein kinase family
- PKC subfamily
Sequence Similarities
Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily.
Clinical Relevance
Disease Involvement
Cancer-related genesFDA approved drug targetsProto-oncogene
Related Diseases
Biomarker
Investigative; Approved; Terminated; Phase 2
Drug Targets
FDA approved drug targets
Drugs
CI-1040NULL4-PHENYLBUTYRIC ACIDTRISMETHOXYRESVERATROLAPRINOCARSENGSK-690693UCN-01ENZASTAURINPHORBOL 12-MYRISTATE 13-ACETATEBEVACIZUMAB-AWWBDIURETICINGENOL MEBUTATESOTRASTAURINBRYOSTATINMIDOSTAURINBRYOSTATIN 1ENOXOLONEREDIOCIDE ACEP-2563DIMETHYLSPINGOSINEHYDROCHLOROTHIAZIDESOTRASTAURIN ACETATERESVERATROLCHEMBL:CHEMBL27768QUERCETIN
Interaction Protein
ENSG00000126583ENSG00000146648
Interaction Count
2
Interaction Dataset
intact_biogrid