Protein detail
NEUM
Neuromodulin (Axonal membrane protein GAP-43) (Growth-associated protein 43) (Neural phosphoprotein B-50) (pp46)
Entry name NEUM | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Plasma proteinsPredicted intracellular proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Neuromodulin (Axonal membrane protein GAP-43) (Growth-associated protein 43) (Neural phosphoprotein B-50) (pp46)
Protein Class (3)
Plasma proteinsPredicted intracellular proteinsTransporters
Protein Function (2)
- Transporters:Transporter channels and pores
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
B-50GAP-43PP46
Gene Description
Growth associated protein 43
Chromosome
3
Position
115623510-115721490
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Tissue SpecificintestineCell SpecificColonocytes
Function & Pathway
Protein Function (2)
- Transporters:Transporter channels and pores
- Predicted intracellular proteins
Cellular Component (9)
Molecular Function (5)
Biological Process (3)
Mediation Categories
Receptor-signaling mediation
Relations & Evidence23
Enzyme-Mediated Modification (11)
11 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| GAP43 | PRKCB | P05771 | S | 41 | phosphorylation | SIGNOR_ProtMapperKEASIGNORProtMapper | KEA:2140056SIGNOR:2140056KEA:17570479KEA:8694767ProtMapper:2140056 |
| GAP43 | PRKCB | P05771 | S | 77 | phosphorylation | MIMPHPRD_MIMPPhosphoSite_MIMP | |
| GAP43 | CSNK2A1 | P68400 | S | 202 | phosphorylation | SIGNOR_ProtMapperKEASIGNORProtMapper | SIGNOR:1828073ProtMapper:1828073KEA:1828073 |
| GAP43 | CSNK2A1 | P68400 | S | 203 | phosphorylation | SIGNOR_ProtMapperKEASIGNORProtMapper | SIGNOR:1828073ProtMapper:1828073KEA:9349568KEA:1828073 |
| GAP43 | CSNK2A1 | P68400 | S | 238 | phosphorylation | MIMPHPRD_MIMP | |
| GAP43 | CSNK2A1 | P68400 | S | 239 | phosphorylation | MIMPHPRD_MIMP | |
| GAP43 | CSNK2A1 | P68400 | T | 87 | phosphorylation | KEA | KEA:9349568 |
| GAP43 | CSNK2A2 | P19784 | S | 203 | phosphorylation | KEA | KEA:17570479 |
| GAP43 | MAPK1 | P28482 | S | 151 | phosphorylation | KEA | KEA:8077193 |
| GAP43 | MAPK14 | Q16539 | S | 96 | phosphorylation | KEA | KEA:17570479 |
Page 1 of 2Next
Ligand-Receptor Signaling (7)
7 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath |
Regulatory Interaction Network (3)
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| LYPA2 | O95372 | NEUM | P17677 | Yes | Yes | SIGNOR | SIGNOR:21152083 | |
| KPCB | P05771 | NEUM | P17677 | Yes | PhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperNetworKIN_KEA | HPRD:8694767KEA:2140056HPRD:2140056SIGNOR:2140056KEA:17570479KEA:8694767ProtMapper:8694767ProtMapper:2140056 | ||
| CSK21 | P68400 | NEUM | P17677 | Yes | MIMPHPRD_MIMPiPTMnetSIGNORProtMapperHPRDPhosphoSite_KEAKEAKinexus_KEAHPRD_KEASIGNOR_ProtMapper | ProtMapper:1828073HPRD:1828073KEA:1828073SIGNOR:1828073KEA:9349568 |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| NA | Mass spectrometryMass spectrometry [LTQ-FT Ultra] | 1 | 38780182 |
Sequence, Structure & Domains
Sequences
Length
238
Mass
24,803
Sequence
MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P17677-1; Sequence=Displayed; Name=2; IsoId=P17677-2; Sequence=VSP_042783
Alternative Sequence
1..10; MLCCMRRTKQ -> MTKSCSELCHPALHFLPCLGGLRKNLQRAVRPSPYSLGFLTFWISR (in isoform 2)
Domain & Motif Annotations
Compositional Bias
9..32; Basic and acidic residues; 54..83; Basic and acidic residues; 84..95; Low complexity; 97..116; Basic and acidic residues; 119..130; Low complexity; 139..154; Polar residues; 155..167; Basic and acidic residues; 168..199; Low complexity; 213..225; Basic and acidic residues; 226..238; Acidic residues
Domain (FT)
31..60; IQ
Region
1..238; Disordered
Protein Families
Neuromodulin family
Sequence Similarities
Belongs to the neuromodulin family.
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 39940641 | Disease-Associated Signatures Persist in Extracellular Vesicles from Reprogrammed Cells of Osteoarthritis Patients. | No related sentences available |