Protein detail

NEUM

Neuromodulin (Axonal membrane protein GAP-43) (Growth-associated protein 43) (Neural phosphoprotein B-50) (pp46)

Entry name NEUM	UniProt ID P17677	EVMP confidence score 0.50
Supporting publications (n) 1	Transmembrane count	Protein classification Plasma proteinsPredicted intracellular proteinsTransporters

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Neuromodulin (Axonal membrane protein GAP-43) (Growth-associated protein 43) (Neural phosphoprotein B-50) (pp46)

Protein Class (3)

Plasma proteinsPredicted intracellular proteinsTransporters

Protein Function (2)

Transporters:Transporter channels and pores
Predicted intracellular proteins

Ensembl

ENSG00000172020

Entrez Gene Symbol

GAP43

Gene Synonym (3)

B-50GAP-43PP46

Gene Description

Growth associated protein 43

Chromosome

Position

115623510-115721490

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization2

Tissue SpecificintestineCell SpecificColonocytes

Function & Pathway6

Protein Function (2)

Transporters:Transporter channels and pores
Predicted intracellular proteins

Cellular Component (9)

Molecular Function (5)

Biological Process (3)

Reactome (2)

Mediation Categories

Receptor-signaling mediation

Relations & Evidence23

Enzyme-Mediated Modification (11)

11 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
GAP43	PRKCB	P05771	S	41	phosphorylation	SIGNOR_ProtMapperKEASIGNORProtMapper	KEA:2140056 SIGNOR:2140056 KEA:17570479 KEA:8694767 ProtMapper:2140056
GAP43	PRKCB	P05771	S	77	phosphorylation	MIMPHPRD_MIMPPhosphoSite_MIMP
GAP43	CSNK2A1	P68400	S	202	phosphorylation	SIGNOR_ProtMapperKEASIGNORProtMapper	SIGNOR:1828073 ProtMapper:1828073 KEA:1828073
GAP43	CSNK2A1	P68400	S	203	phosphorylation	SIGNOR_ProtMapperKEASIGNORProtMapper	SIGNOR:1828073 ProtMapper:1828073 KEA:9349568 KEA:1828073
GAP43	CSNK2A1	P68400	S	238	phosphorylation	MIMPHPRD_MIMP
GAP43	CSNK2A1	P68400	S	239	phosphorylation	MIMPHPRD_MIMP
GAP43	CSNK2A1	P68400	T	87	phosphorylation	KEA	KEA:9349568
GAP43	CSNK2A2	P19784	S	203	phosphorylation	KEA	KEA:17570479
GAP43	MAPK1	P28482	S	151	phosphorylation	KEA	KEA:8077193
GAP43	MAPK14	Q16539	S	96	phosphorylation	KEA	KEA:17570479

Page 1 of 2Next

Ligand-Receptor Signaling (7)

7 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	No	No	No
plasma_membrane	plasma_membrane	OmniPath	No	No	No	No	No

Regulatory Interaction Network (3)

3 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
LYPA2	O95372	NEUM	P17677	Yes	No	Yes	SIGNOR	SIGNOR:21152083
KPCB	P05771	NEUM	P17677	Yes	No	No	PhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperNetworKIN_KEA	HPRD:8694767 KEA:2140056 HPRD:2140056 SIGNOR:2140056 KEA:17570479 KEA:8694767 ProtMapper:8694767 ProtMapper:2140056
CSK21	P68400	NEUM	P17677	Yes	No	No	MIMPHPRD_MIMPiPTMnetSIGNORProtMapperHPRDPhosphoSite_KEAKEAKinexus_KEAHPRD_KEASIGNOR_ProtMapper	ProtMapper:1828073 HPRD:1828073 KEA:1828073 SIGNOR:1828073 KEA:9349568

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	AIDA C1orf21 GAP43 TMEM185A TMEM185B	P17677 Q8NFB2 Q96BJ3 Q9H246 Q9H7F4	0:0:0:0:0	hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
NA	Mass spectrometryMass spectrometry [LTQ-FT Ultra]	1	38780182

Sequence, Structure & Domains10

Sequences

Length

238

Mass

24,803

Sequence

MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P17677-1; Sequence=Displayed; Name=2; IsoId=P17677-2; Sequence=VSP_042783

Alternative Sequence

1..10; MLCCMRRTKQ -> MTKSCSELCHPALHFLPCLGGLRKNLQRAVRPSPYSLGFLTFWISR (in isoform 2)

Domain & Motif Annotations

Compositional Bias

9..32; Basic and acidic residues; 54..83; Basic and acidic residues; 84..95; Low complexity; 97..116; Basic and acidic residues; 119..130; Low complexity; 139..154; Polar residues; 155..167; Basic and acidic residues; 168..199; Low complexity; 213..225; Basic and acidic residues; 226..238; Acidic residues

Domain (FT)

31..60; IQ

Region

1..238; Disordered

Protein Families

Neuromodulin family

Sequence Similarities

Belongs to the neuromodulin family.

Clinical Relevance1

Antibody (4)

CAB004417 HPA013392 HPA015600 CAB078783

Supporting Publications1

PMID	Title	Abstract
39940641	Disease-Associated Signatures Persist in Extracellular Vesicles from Reprogrammed Cells of Osteoarthritis Patients.	No abstract available