Protein detail
RHCE
Blood group Rh(CE) polypeptide (Rh polypeptide 1) (RhPI) (Rh30A) (RhIXB) (Rhesus C/E antigens) (CD antigen CD240CE)
Entry name RHCE | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 2 | Transmembrane count 11 | Protein classification Blood group antigen proteinsCD markersDisease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Blood group Rh(CE) polypeptide (Rh polypeptide 1) (RhPI) (Rh30A) (RhIXB) (Rhesus C/E antigens) (CD antigen CD240CE)
Protein Class (7)
Blood group antigen proteinsCD markersDisease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function (6)
- Predicted intracellular proteins
- Blood group antigen proteins
- CD markers
- Potential drug targets
- Transporters:Transporter channels and pores
- Disease related genes
Transmembrane
12..32; Helical; 44..64; Helical; 77..97; Helical; 125..145; Helical; 172..192; Helical; 203..223; Helical; 238..258; Helical; 265..285; Helical; 287..307; Helical; 331..351; Helical; 358..378; Helical
Transmembrane Count
11
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
CD240CERH
Gene Description
Rh blood group CcEe antigens
Chromosome
1
Position
25362249-25430192
Supporting publications (n)
2
EVMP confidence score
0.50
Fluorescence & Localization2
Tissue SpecifickidneyCell SpecificCardiomyocytes
Function & Pathway6
Protein Function (6)
- Predicted intracellular proteins
- Blood group antigen proteins
- CD markers
- Potential drug targets
- Transporters:Transporter channels and pores
- Disease related genes
Cellular Component (2)
Molecular Function
Biological Process (3)
Reactome (2)
Mediation Categories (2)
Fusion and delivery mediationMetabolism mediation
Relations & Evidence13
Ligand-Receptor Signaling (10)
10 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| solute_carrier | transporter | Almen2009 | No | Yes | No | No | No |
| transporter | transporter | OmniPath | No | Yes | No | No | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | No | No |
| transmembrane | transmembrane | TopDB | No | No | No | No | No |
| transmembrane | transmembrane | LOCATE | No | No | No | No | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | No | No |
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | No | No |
Protein Complex Composition (2)
Isolation & Detection Technology (1)
Sequence, Structure & Domains11
Sequences
Length
417
Mass
45,451
Sequence
MSSKYPRSVRRCLPLCALTLEAALILLFYFFTHYDASLEDQKGLVASYQVGQDLTVMAALGLGFLTSNFRRHSWSSVAFNLFMLALGVQWAILLDGFLSQFPPGKVVITLFSIRLATMSAMSVLISAGAVLGKVNLAQLVVMVLVEVTALGTLRMVISNIFNTDYHMNLRHFYVFAAYFGLTVAWCLPKPLPKGTEDNDQRATIPSLSAMLGALFLWMFWPSVNSALLRSPIQRKNAMFNTYYALAVSVVTAISGSSLAHPQRKISMTYVHSAVLAGGVAVGTSCHLIPSPWLAMVLGLVAGLISIGGAKCLPVCCNRVLGIHHISVMHSIFSLLGLLGEITYIVLLVLHTVWNGNGMIGFQVLLSIGELSLAIVIALTSGLLTGLLLNLKIWKAPHVAKYFDDQVFWKFPHLAVGF
Alternative Products
Event=Alternative splicing; Named isoforms=14; Name=RHI; IsoId=P18577-1; Sequence=Displayed; Name=RHIV; Synonyms=1e; IsoId=P18577-2; Sequence=VSP_005703, VSP_005704; Name=RHVI; Synonyms=7c; IsoId=P18577-3; Sequence=VSP_005702, VSP_005705; Name=RHVIII; IsoId=P18577-4; Sequence=VSP_005701; Name=1c; IsoId=P18577-5; Sequence=VSP_005705; Name=1d; IsoId=P18577-6; Sequence=VSP_037514; Name=1h; IsoId=P18577-7; Sequence=VSP_037513; Name=2e; IsoId=P18577-8; Sequence=VSP_037510, VSP_037512; Name=4g; Synonyms=RhPI-Beta; IsoId=P18577-9; Sequence=VSP_037509; Name=7a; IsoId=P18577-10; Sequence=VSP_005702; Name=8a; IsoId=P18577-11; Sequence=VSP_037506, VSP_037511; Name=8e; IsoId=P18577-12; Sequence=VSP_037507, VSP_037508; Name=8h; IsoId=P18577-13; Sequence=VSP_037505; Name=RhPI-Alpha; IsoId=P18577-14; Sequence=VSP_038405, VSP_038406
Alternative Sequence
163..409; Missing (in isoform 8h); 163..313; Missing (in isoform RHVIII); 163..220; Missing (in isoform 8a); 163..203; TDYHMNLRHFYVFAAYFGLTVAWCLPKPLPKGTEDNDQRAT -> DWLPGPPQHWGTQLGHRDSSHVWSPDRFAPKSQNMESTSCG (in isoform 8e); 164..268; Missing (in isoform RHVI and isoform 7a); 204..417; Missing (in isoform 8e); 212..384; Missing (in isoform 4g); 227..242; LLRSPIQRKNAMFNTY -> DRFAPKSQNMESTSCG (in isoform RhPI-Alpha); 243..417; Missing (in isoform RhPI-Alpha); 268..308; TYVHSAVLAGGVAVGTSCHLIPSPWLAMVLGLVAGLISIGG -> DWLPGPPQHWGTQLGHRDSSHVWSPDRFAPKSQNMESTSCG (in isoform 2e); 301..313; Missing (in isoform 8a); 309..417; Missing (in isoform 2e); 314..409; Missing (in isoform 1h); 314..354; VCCNRVLGIHHISVMHSIFSLLGLLGEITYIVLLVLHTVWN -> DWLPGPPQHWGTQLGHRDSSHVWSPDRFAPKSQNMESTSCG (in isoform RHIV); 355..417; Missing (in isoform RHIV); 358..417; MIGFQVLLSIGELSLAIVIALTSGLLTGLLLNLKIWKAPHVAKYFDDQVFWKFPHLAVGF -> IFLIWLLDFKQKHPRKTRPVQKQDNFLSLLPAVREKRS (in isoform 1d); 359..417; IGFQVLLSIGELSLAIVIALTSGLLTGLLLNLKIWKAPHVAKYFDDQVFWKFPHLAVGF -> FAPKSQNMESTSCG (in isoform RHVI and isoform 1c)
3D Structural Models
Turn
66..68; 128..132; 257..259; 281..287; 312..314
Helix
12..31; 44..59; 61..65; 73..98; 110..127; 136..161; 167..171; 172..186; 203..219; 220..222; 231..256; 267..273; 276..280; 291..311; 327..347; 361..388; 391..393; 398..400; 404..406
Beta Strand
32..34; 69..71; 106..108; 224..227; 263..265
3D Structure
Electron microscopy (8)
Domain & Motif Annotations
Protein Families (2)
- Ammonium transporter (TC 2.A.49) family
- Rh subfamily
Sequence Similarities
Belongs to the ammonium transporter (TC 2.A.49) family. Rh subfamily.
Supporting Publications2
| PMID | Title | Abstract |
|---|---|---|
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No abstract available |
| 41216884 | Extracellular Vesicles From Multiple Sclerosis White Matter Exhibit Synaptic, Mitochondrial, Complement and Ageing-Related Pathway Dysregulation. | No abstract available |