Protein detail

RHCE

Blood group Rh(CE) polypeptide (Rh polypeptide 1) (RhPI) (Rh30A) (RhIXB) (Rhesus C/E antigens) (CD antigen CD240CE)

Entry name RHCE	UniProt ID P18577	EVMP confidence score 0.50
Supporting publications (n) 2	Transmembrane count 11	Protein classification Blood group antigen proteinsCD markersDisease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Blood group Rh(CE) polypeptide (Rh polypeptide 1) (RhPI) (Rh30A) (RhIXB) (Rhesus C/E antigens) (CD antigen CD240CE)

Protein Class (7)

Blood group antigen proteinsCD markersDisease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters

Protein Function (6)

Predicted intracellular proteins
Blood group antigen proteins
CD markers
Potential drug targets
Transporters:Transporter channels and pores
Disease related genes

Transmembrane

12..32; Helical; 44..64; Helical; 77..97; Helical; 125..145; Helical; 172..192; Helical; 203..223; Helical; 238..258; Helical; 265..285; Helical; 287..307; Helical; 331..351; Helical; 358..378; Helical

Transmembrane Count

Ensembl

ENSG00000188672

Entrez Gene Symbol

RHCE

Gene Synonym (2)

CD240CERH

Gene Description

Rh blood group CcEe antigens

Chromosome

Position

25362249-25430192

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization2

Tissue SpecifickidneyCell SpecificCardiomyocytes

Function & Pathway6

Protein Function (6)

Predicted intracellular proteins
Blood group antigen proteins
CD markers
Potential drug targets
Transporters:Transporter channels and pores
Disease related genes

Cellular Component (2)

Molecular Function

GO:0008519 ammonium channel activity

Biological Process (3)

Reactome (2)

Mediation Categories (2)

Fusion and delivery mediationMetabolism mediation

Relations & Evidence13

Ligand-Receptor Signaling (10)

10 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
solute_carrier	transporter	Almen2009	No	Yes	No	No	No
transporter	transporter	OmniPath	No	Yes	No	No	No
transmembrane	transmembrane	UniProt_location	No	No	No	No	No
transmembrane	transmembrane	UniProt_topology	No	No	No	No	No
transmembrane	transmembrane	UniProt_keyword	No	No	No	No	No
transmembrane	transmembrane	TopDB	No	No	No	No	No
transmembrane	transmembrane	LOCATE	No	No	No	No	No
transmembrane	transmembrane	Ramilowski_location	No	No	No	No	No
transmembrane	transmembrane	OmniPath	No	No	No	No	No
transmembrane	transmembrane_predicted	Phobius	No	No	No	No	No

Protein Complex Composition (2)

2 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	ANK1 RHAG RHCE	P16157 P18577 Q02094	1:1:2	PDB	PDB:7v0sPDB:7uzq
	RHAG RHCE	P18577 Q02094	1:2	PDB	PDB:8csx

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyImmunoaffinity Capture	Mass spectrometry	7	38731868 30071318 40619995 40098346 31320591 38136601 34889606

Sequence, Structure & Domains11

Sequences

Length

417

Mass

45,451

Sequence

MSSKYPRSVRRCLPLCALTLEAALILLFYFFTHYDASLEDQKGLVASYQVGQDLTVMAALGLGFLTSNFRRHSWSSVAFNLFMLALGVQWAILLDGFLSQFPPGKVVITLFSIRLATMSAMSVLISAGAVLGKVNLAQLVVMVLVEVTALGTLRMVISNIFNTDYHMNLRHFYVFAAYFGLTVAWCLPKPLPKGTEDNDQRATIPSLSAMLGALFLWMFWPSVNSALLRSPIQRKNAMFNTYYALAVSVVTAISGSSLAHPQRKISMTYVHSAVLAGGVAVGTSCHLIPSPWLAMVLGLVAGLISIGGAKCLPVCCNRVLGIHHISVMHSIFSLLGLLGEITYIVLLVLHTVWNGNGMIGFQVLLSIGELSLAIVIALTSGLLTGLLLNLKIWKAPHVAKYFDDQVFWKFPHLAVGF

Alternative Products

Event=Alternative splicing; Named isoforms=14; Name=RHI; IsoId=P18577-1; Sequence=Displayed; Name=RHIV; Synonyms=1e; IsoId=P18577-2; Sequence=VSP_005703, VSP_005704; Name=RHVI; Synonyms=7c; IsoId=P18577-3; Sequence=VSP_005702, VSP_005705; Name=RHVIII; IsoId=P18577-4; Sequence=VSP_005701; Name=1c; IsoId=P18577-5; Sequence=VSP_005705; Name=1d; IsoId=P18577-6; Sequence=VSP_037514; Name=1h; IsoId=P18577-7; Sequence=VSP_037513; Name=2e; IsoId=P18577-8; Sequence=VSP_037510, VSP_037512; Name=4g; Synonyms=RhPI-Beta; IsoId=P18577-9; Sequence=VSP_037509; Name=7a; IsoId=P18577-10; Sequence=VSP_005702; Name=8a; IsoId=P18577-11; Sequence=VSP_037506, VSP_037511; Name=8e; IsoId=P18577-12; Sequence=VSP_037507, VSP_037508; Name=8h; IsoId=P18577-13; Sequence=VSP_037505; Name=RhPI-Alpha; IsoId=P18577-14; Sequence=VSP_038405, VSP_038406

Alternative Sequence

163..409; Missing (in isoform 8h); 163..313; Missing (in isoform RHVIII); 163..220; Missing (in isoform 8a); 163..203; TDYHMNLRHFYVFAAYFGLTVAWCLPKPLPKGTEDNDQRAT -> DWLPGPPQHWGTQLGHRDSSHVWSPDRFAPKSQNMESTSCG (in isoform 8e); 164..268; Missing (in isoform RHVI and isoform 7a); 204..417; Missing (in isoform 8e); 212..384; Missing (in isoform 4g); 227..242; LLRSPIQRKNAMFNTY -> DRFAPKSQNMESTSCG (in isoform RhPI-Alpha); 243..417; Missing (in isoform RhPI-Alpha); 268..308; TYVHSAVLAGGVAVGTSCHLIPSPWLAMVLGLVAGLISIGG -> DWLPGPPQHWGTQLGHRDSSHVWSPDRFAPKSQNMESTSCG (in isoform 2e); 301..313; Missing (in isoform 8a); 309..417; Missing (in isoform 2e); 314..409; Missing (in isoform 1h); 314..354; VCCNRVLGIHHISVMHSIFSLLGLLGEITYIVLLVLHTVWN -> DWLPGPPQHWGTQLGHRDSSHVWSPDRFAPKSQNMESTSCG (in isoform RHIV); 355..417; Missing (in isoform RHIV); 358..417; MIGFQVLLSIGELSLAIVIALTSGLLTGLLLNLKIWKAPHVAKYFDDQVFWKFPHLAVGF -> IFLIWLLDFKQKHPRKTRPVQKQDNFLSLLPAVREKRS (in isoform 1d); 359..417; IGFQVLLSIGELSLAIVIALTSGLLTGLLLNLKIWKAPHVAKYFDDQVFWKFPHLAVGF -> FAPKSQNMESTSCG (in isoform RHVI and isoform 1c)

3D Structural Models

Turn

66..68; 128..132; 257..259; 281..287; 312..314

Helix

12..31; 44..59; 61..65; 73..98; 110..127; 136..161; 167..171; 172..186; 203..219; 220..222; 231..256; 267..273; 276..280; 291..311; 327..347; 361..388; 391..393; 398..400; 404..406

Beta Strand

32..34; 69..71; 106..108; 224..227; 263..265

3D Structure

Electron microscopy (8)

Domain & Motif Annotations

Protein Families (2)

Ammonium transporter (TC 2.A.49) family
Rh subfamily

Sequence Similarities

Belongs to the ammonium transporter (TC 2.A.49) family. Rh subfamily.

Clinical Relevance1

Antibody (2)

HPA060951 HPA077385

Supporting Publications2

PMID	Title	Abstract
38731868	The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer.	No abstract available
41216884	Extracellular Vesicles From Multiple Sclerosis White Matter Exhibit Synaptic, Mitochondrial, Complement and Ageing-Related Pathway Dysregulation.	No abstract available