Protein detail
CADH2
Cadherin-2 (CDw325) (Neural cadherin) (N-cadherin) (CD antigen CD325)
Entry name CADH2 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification CD markersDisease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Cadherin-2 (CDw325) (Neural cadherin) (N-cadherin) (CD antigen CD325)
Protein Class (6)
CD markersDisease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins
Protein Function (5)
- Predicted intracellular proteins
- CD markers
- Disease related genes
- Human disease related genes:Cardiovascular diseases:Cardiac diseases
- Human disease related genes:Congenital malformations:Other congenital malformations
Transmembrane
725..745; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
CD325CDHNNCAD
Gene Description
Cadherin 2
Chromosome
18
Position
27932879-28177946
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization3
Tissue Specificheart muscleCell SpecificCardiomyocytesSingle-Nuclei Brain Specificastrocyte
Function & Pathway8
Protein Function (5)
- Predicted intracellular proteins
- CD markers
- Disease related genes
- Human disease related genes:Cardiovascular diseases:Cardiac diseases
- Human disease related genes:Congenital malformations:Other congenital malformations
Cellular Component (25)
- GO:0005737 cytoplasm
- GO:0005788 endoplasmic reticulum lumen
- GO:0005886 plasma membrane
- GO:0005911 cell-cell junction
- GO:0005912 adherens junction
- GO:0005916 fascia adherens
- GO:0005925 focal adhesion
- GO:0009986 cell surface
- GO:0014069 postsynaptic density
- GO:0014704 intercalated disc
Page 1 of 3
Molecular Function (10)
- GO:0003723 RNA binding
- GO:0005509 calcium ion binding
- GO:0005515 protein binding
- GO:0008013 beta-catenin binding
- GO:0019901 protein kinase binding
- GO:0019903 protein phosphatase binding
- GO:0042802 identical protein binding
- GO:0045294 alpha-catenin binding
- GO:0045295 gamma-catenin binding
- GO:0045296 cadherin binding
Biological Process (3)
KEGG (4)
Reactome (9)
- R-hsa-418990 adherens junctions interactions
- R-hsa-1500931 cell cell communication
- R-hsa-446728 cell junction organization
- R-hsa-9856651 mitf m dependent gene expression
- R-hsa-9730414 mitf m regulated melanocyte development
- R-hsa-525793 myogenesis
- R-hsa-597592 post translational protein modification
- R-hsa-381426 regulation of insulin like growth factor igf transport and uptake by insulin like growth factor binding proteins igfbps
- R-hsa-9926550 regulation of mitf m dependent genes involved in extracellular matrix focal adhesion and epithelial to mesenchymal transition
Canonical Pathways
M7 Pid fcer1 pathway
Mediation Categories (5)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence67
Enzyme-Mediated Modification (6)
6 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| CDH2 | SRC | P12931 | Y | 884 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPSIGNORProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | KEA:16371504phosphoELM:16371504SIGNOR:16371504KEA:10502299ProtMapper:16371504 |
| CDH2 | SRC | P12931 | Y | 852 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPSIGNORProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | KEA:16371504phosphoELM:16371504SIGNOR:16371504KEA:10502299ProtMapper:16371504 |
| CDH2 | SRC | P12931 | Y | 860 | phosphorylation | PhosphoSite_MIMPMIMPSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:16371504ProtMapper:16371504 |
| CDH2 | SRC | P12931 | Y | 886 | phosphorylation | PhosphoSite_MIMPMIMPSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:16371504ProtMapper:16371504 |
| CDH2 | SRC | P12931 | Y | 820 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| CDH2 | GDNF | P39905 | Y | 860 | phosphorylation | REACH_ProtMapperSparser_ProtMapperProtMapper | ProtMapper:24254198 |
Ligand-Receptor Signaling (51)
51 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| cell_adhesion | cell_adhesion | Almen2009 | Yes | Yes | No | Yes | No |
| cell_adhesion | cell_adhesion | HGNC | Yes | Yes | No | Yes | No |
| adhesion | adhesion | OmniPath | Yes | Yes | No | Yes | No |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | No | Yes | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | Yes | No |
| transmembrane_predicted | transmembrane | OmniPath | No | No | No | Yes | No |
| transmembrane | transmembrane | CellPhoneDB | No | No | No | Yes | No |
| transmembrane | transmembrane | TopDB | No | No | No | Yes | No |
Regulatory Interaction Network (7)
7 records.
Protein Complex Composition (2)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion ChromatographyImmunoaffinity Capture | Mass Spectrometry | 1 | 38113368 |
Sequence, Structure & Domains9
Sequences
Length
906
Mass
99,809
Sequence
MCRIAGALRTLLPLLAALLQASVEASGEIALCKTGFPEDVYSAVLSKDVHEGQPLLNVKFSNCNGKRKVQYESSEPADFKVDEDGMVYAVRSFPLSSEHAKFLIYAQDKETQEKWQVAVKLSLKPTLTEESVKESAEVEEIVFPRQFSKHSGHLQRQKRDWVIPPINLPENSRGPFPQELVRIRSDRDKNLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDREQIARFHLRAHAVDINGNQVENPIDIVINVIDMNDNRPEFLHQVWNGTVPEGSKPGTYVMTVTAIDADDPNALNGMLRYRIVSQAPSTPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQATDMEGNPTYGLSNTATAVITVTDVNDNPPEFTAMTFYGEVPENRVDIIVANLTVTDKDQPHTPAWNAVYRISGGDPTGRFAIQTDPNSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDPDRYMQQNIRYTKLSDPANWLKIDPVNGQITTIAVLDRESPNVKNNIYNATFLASDNGIPPMSGTGTLQIYLLDINDNAPQVLPQEAETCETPDPNSINITALDYDIDPNAGPFAFDLPLSPVTIKRNWTITRLNGDFAQLNLKIKFLEAGIYEVPIIITDSGNPPKSNISILRVKVCQCDSNGDCTDVDRIVGAGLGTGAIIAILLCIIILLILVLMFVVWMKRRDKERQAKQLLIDPEDDVRDNILKYDEEGGGEEDQDYDLSQLQQPDTVEPDAIKPVGIRRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P19022-1; Sequence=Displayed; Name=2; IsoId=P19022-2; Sequence=VSP_056448
Alternative Sequence
1..57; MCRIAGALRTLLPLLAALLQASVEASGEIALCKTGFPEDVYSAVLSKDVHEGQPLLN -> MFLLRRYVCIFTEKLKNQAELYVFLS (in isoform 2)
Domain & Motif Annotations
Compositional Bias
863..880; Low complexity
Domain (CC)
Three calcium ions are usually bound at the interface of each cadherin domain and rigidify the connections, imparting a strong curvature to the full-length ectodomain. Calcium-binding sites are occupied sequentially in the order of site 3, then site 2 and site 1..
Domain (FT)
160..267; Cadherin 1; 268..382; Cadherin 2; 383..497; Cadherin 3; 498..603; Cadherin 4; 604..714; Cadherin 5
Region
863..884; Disordered
Clinical Relevance8
Disease Involvement (3)
CardiomyopathyDisease variantIntellectual disability
Related Diseases
Biomarker
Phase 2
Interaction Protein (4)
ENSG00000044115ENSG00000168036ENSG00000173801ENSG00000198561
Interaction Count
4
Interaction Dataset (3)
biogrid_opencellintact_biogrid_opencellintact_biogrid
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 32384937 | Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles. | No abstract available |