Protein detail
TSN8
Tetraspanin-8 (Tspan-8) (Transmembrane 4 superfamily member 3) (Tumor-associated antigen CO-029)
Entry name TSN8 | UniProt ID | EVMP confidence score 0.47 |
Supporting publications (n) 14 | Transmembrane count 4 | Protein classification Cancer-related genesPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Tetraspanin-8 (Tspan-8) (Transmembrane 4 superfamily member 3) (Tumor-associated antigen CO-029)
Protein Class (2)
Cancer-related genesPredicted membrane proteins
Protein Function
Cancer-related genes:Candidate cancer biomarkers
Transmembrane
10..33; Helical; 58..72; Helical; 84..109; Helical; 206..230; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
CO-029TM4SF3
Gene Description
Tetraspanin 8
Chromosome
12
Position
71125085-71441898
Supporting publications (n)
14
EVMP confidence score
0.47
Fluorescence & Localization5
Tissue SpecificbreastCell SpecificBreast secretory cellsSingle-Nuclei Brain Specificcerebellar inhibitoryBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes
Function & Pathway5
Protein Function
Cancer-related genes:Candidate cancer biomarkers
Cellular Component (3)
Molecular Function (2)
Biological Process (3)
Mediation Categories
Immune mediation
Relations & Evidence21
Ligand-Receptor Signaling (20)
20 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | HPMR | No | Yes | No | Yes | No |
| tetraspanins | receptor | HPMR | No | Yes | No | Yes | No |
| tet3 | receptor | HPMR | No | Yes | No | Yes | No |
| receptor | receptor | OmniPath | No | Yes | No | Yes | No |
| extracellular | extracellular | HPMR | No | No | No | Yes | No |
| extracellular | extracellular | OmniPath | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | Yes | No |
| transmembrane | transmembrane | TopDB | No | No | No | Yes | No |
Page 1 of 2Next
Sequence, Structure & Domains5
Sequences
Length
237
Mass
26,044
Sequence
MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYVAVDILIAVGAIIMILGFLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKNLIIVIGISFGLAVIEILGLVFSMVLYCQIGNK
Domain & Motif Annotations
Protein Families
Tetraspanin (TM4SF) family
Sequence Similarities
Belongs to the tetraspanin (TM4SF) family.
Clinical Relevance5
Supporting Publications14
| PMID | Title | Abstract |
|---|---|---|
| 32195353 | Extracellular vesicle tetraspanin-8 level predicts distant metastasis in non-small cell lung cancer after concurrent chemoradiation. | We used proteomics to identify proteins differentially expressed on extracellular vesicles (EVs) of nonmetastatic 393P and metastatic 344SQ NSCLC cell lines and found that tetraspanin-8 (Tspan8) was selectively enriched on 344SQ EVs. |
| 33773551 | Exosomal Protease Cargo as Prognostic Biomarker in Colorectal Cancer. | Protease cargo in CD9-positive blood plasma exosomes is prognostic biomarker for colorectal polyps and colorectal cancer. The levels of 20S proteasomes and ADAM10+/ADAM17- subpopulations in CD9-positive blood plasma exosomes are the most significant values for predicting relapse-free survival. The levels of 20S proteasomes in exosomes, MMP9+, MMP9+/MMP2+/EMMPRIN+ in CD9-positive blood plasma exosomes are associated with the risk of malignant transformation of colorectal tubulovillous adenomas. The subpopulations of CD151- and Tspan8-positive exosomes, the subpopulations of metalloproteinase at the surface of СD9-positive exosomes and the level of 20S proteasomes in plasma exosomes in 15 CPPs (tubulovillous adenomas) and 60 CRCPs were evaluated using flow cytometry and Western blotting. |
| 36613908 | Comparative Analysis of Tumor-Associated microRNAs and Tetraspanines from Exosomes of Plasma and Ascitic Fluids of Ovarian Cancer Patients. | CD151- and Tspan8-positive exosomes are known to support the degradation of the extracellular matrix, and are involved in stroma remodeling, angiogenesis and cell motility, as well as the association of miR-24 and miR-101 with these processes. |
| 38139054 | Lung Cancer Cell-Derived Exosome Detection Using Electrochemical Approach towards Early Cancer Screening. | The cell-derived exosomes were successfully immobilized on the FTO electrode through the CD-151 antibody, and cyclic voltammetry (CV) and electrochemical impedance spectroscopy (EIS) methods were used in this research. |
Page 2 of 2Previous