Protein detail
LFA3
Lymphocyte function-associated antigen 3 (Ag3) (Surface glycoprotein LFA-3) (CD antigen CD58)
Entry name LFA3 | UniProt ID | EVMP confidence score 0.25 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information8
Protein Names
Lymphocyte function-associated antigen 3 (Ag3) (Surface glycoprotein LFA-3) (CD antigen CD58)
Protein Function (2)
- Human disease related genes:Cancers:Cancers of haematopoietic and lymphoid tissues
- CD markers
Transmembrane
216..238; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Supporting publications (n)
1
EVMP confidence score
0.25
Fluorescence & Localization4
Tissue SpecificesophagusBrain Regional SpecificcerebellumCell SpecificEsophageal apical cellsSingle-Nuclei Brain Specificchoroid plexus epithelial cell
Function & Pathway7
Protein Function (2)
- Human disease related genes:Cancers:Cancers of haematopoietic and lymphoid tissues
- CD markers
Cellular Component (6)
Molecular Function (2)
Biological Process (3)
Reactome (4)
Mediation Categories (3)
Clinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence43
Ligand-Receptor Signaling (42)
42 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | LOCATE | No | No | No | Yes | Yes |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | Yes | Yes |
| transmembrane | transmembrane | OmniPath | No | No | No | Yes | Yes |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | Yes | Yes |
| plasma_membrane | plasma_membrane | Cellinker | No | No | No | Yes | Yes |
| basolateral_cell_membrane | plasma_membrane | LOCATE | No | No | No | Yes | Yes |
| plasma_membrane | plasma_membrane | LOCATE | No | No | No | Yes | Yes |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | Yes | Yes |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | Membranome | No | No | No | Yes | Yes |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | CSPA | No | No | No | Yes | Yes |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Protein Organic Solvent Precipitation | Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains10
Sequences
Length
250
Mass
28,147
Sequence
MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIPIPLAVITTCIVLYMNGILKCDRKPDRTNSN
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; Synonyms=Long; IsoId=P19256-1; Sequence=Displayed; Name=2; Synonyms=Short; IsoId=P19256-2; Sequence=VSP_002522, VSP_002523; Name=3; IsoId=P19256-3; Sequence=VSP_038693
Alternative Sequence
236..237; GI -> VL (in isoform 2); 238..250; Missing (in isoform 2); 248..250; NSN -> K (in isoform 3)
3D Structural Models
Turn
85..87
Helix
75..77; 97..99
Beta Strand
30..36; 41..43; 54..58; 61..67; 70..73; 80..83; 90..92; 101..106; 114..121
3D Structure
NMR spectroscopy (1); X-ray crystallography (2)
Domain & Motif Annotations
Domain (FT)
30..121; Ig-like
Clinical Relevance3
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 37298418 | Cross-Dressing of Multiple Myeloma Cells Mediated by Extracellular Vesicles Conveying MIC and ULBP Ligands Promotes NK Cell Killing. | The secretion of NKG2D ligands (NKG2DLs) through protease-mediated cleavage or in an extracellular vesicle (EV) is a mode to control their cell surface expression and a mechanism used by cancer cells to evade NKG2D-mediated immunosurveillance. |