Protein detail

CD53

Leukocyte surface antigen CD53 (Cell surface glycoprotein CD53) (Tetraspanin-25) (Tspan-25) (CD antigen CD53)

Entry name CD53	UniProt ID P19397	EVMP confidence score 0.38
Supporting publications (n) 9	Transmembrane count 4	Protein classification CD markersPredicted membrane proteinsTransporters

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Leukocyte surface antigen CD53 (Cell surface glycoprotein CD53) (Tetraspanin-25) (Tspan-25) (CD antigen CD53)

Protein Class (3)

CD markersPredicted membrane proteinsTransporters

Protein Function (2)

CD markers
Transporters:Accessory Factors Involved in Transport

Transmembrane

12..32; Helical; 55..69; Helical; 81..106; Helical; 182..206; Helical

Transmembrane Count

Ensembl

ENSG00000143119

Entrez Gene Symbol

CD53

Gene Synonym (2)

MOX44TSPAN25

Gene Description

CD53 molecule

Chromosome

Position

110871188-110899922

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization5

Tissue Specificchoroid plexusCell SpecificChoroid plexus epithelial cellsSingle-Nuclei Brain SpecificBergmann gliaSecretome LocationIntracellular and membraneSecretome FunctionCell adhesion

Function & Pathway6

Protein Function (2)

CD markers
Transporters:Accessory Factors Involved in Transport

Cellular Component (8)

Molecular Function (3)

Biological Process (3)

Reactome (2)

Mediation Categories (2)

Fusion and delivery mediationImmune mediation

Relations & Evidence40

Ligand-Receptor Signaling (39)

39 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
receptor	receptor	HPMR	No	Yes	No	Yes	No
receptor	receptor	CellTalkDB	No	Yes	No	Yes	No
receptor	receptor	Ramilowski2015	No	Yes	No	Yes	No
receptor	receptor	LRdb	No	Yes	No	Yes	No
receptor	receptor	Baccin2019	No	Yes	No	Yes	No
interleukin	receptor	Baccin2019	No	Yes	No	Yes	No
tetraspanins	receptor	HPMR	No	Yes	No	Yes	No
tm4sf5	receptor	HPMR	No	Yes	No	Yes	No
receptor	receptor	OmniPath	No	Yes	No	Yes	No
extracellular	extracellular	HPMR	No	No	No	Yes	No

Page 1 of 4Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	1	24670152

Sequence, Structure & Domains9

Sequences

Length

219

Mass

24,341

Sequence

MGMSSLKLLKYVLFFFNLLFWICGCCILGFGIYLLIHNNFGVLFHNLPSLTLGNVFVIVGSIIMVVAFLGCMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHSNFLYIGIITICVCVIEVLGMSFALTLNCQIDKTSQTIGL

3D Structural Models

Turn

124..127

Helix

9..37; 52..76; 79..105; 107..123; 129..142; 150..152; 170..180; 182..208

Beta Strand

146..149; 159..161

3D Structure

X-ray crystallography (1)

Domain & Motif Annotations

Protein Families

Tetraspanin (TM4SF) family

Sequence Similarities

Belongs to the tetraspanin (TM4SF) family.

Clinical Relevance1

Antibody

HPA047216

Supporting Publications9

PMID	Title	Abstract
30915084	Extracellular Vesicles Mediate Mesenchymal Stromal Cell-Dependent Regulation of B Cell PI3K-AKT Signaling Pathway and Actin Cytoskeleton.	No abstract available
31382537	An Insight into the Proteome of Uveal Melanoma-Derived Ectosomes Reveals the Presence of Potentially Useful Biomarkers.	No abstract available
31805958	Proteomic analysis of cerebrospinal fluid extracellular vesicles reveals synaptic injury, inflammation, and stress response markers in HIV patients with cognitive impairment.	No abstract available
32560723	T2 and T17 cytokines alter the cargo and function of airway epithelium-derived extracellular vesicles.	No abstract available
37563857	Comprehensive characterization of human brain-derived extracellular vesicles using multiple isolation methods: Implications for diagnostic and therapeutic applications.	No abstract available
38113368	In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum.	No abstract available
38207106	Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity.	No abstract available
40189497	Small extracellular vesicle-based one-step high-throughput microfluidic platform for epithelial ovarian cancer diagnosis.	No abstract available
40985879	TurboID-Mediated Profiling of Glioblastoma-Derived Extracellular Vesicle Cargo Proteins.	No abstract available