Protein detail
CD53
Leukocyte surface antigen CD53 (Cell surface glycoprotein CD53) (Tetraspanin-25) (Tspan-25) (CD antigen CD53)
Entry name CD53 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 9 | Transmembrane count 4 | Protein classification CD markersPredicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Leukocyte surface antigen CD53 (Cell surface glycoprotein CD53) (Tetraspanin-25) (Tspan-25) (CD antigen CD53)
Protein Class (3)
CD markersPredicted membrane proteinsTransporters
Protein Function (2)
- CD markers
- Transporters:Accessory Factors Involved in Transport
Transmembrane
12..32; Helical; 55..69; Helical; 81..106; Helical; 182..206; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
MOX44TSPAN25
Gene Description
CD53 molecule
Chromosome
1
Position
110871188-110899922
Supporting publications (n)
9
EVMP confidence score
0.38
Fluorescence & Localization5
Tissue Specificchoroid plexusCell SpecificChoroid plexus epithelial cellsSingle-Nuclei Brain SpecificBergmann gliaSecretome LocationIntracellular and membraneSecretome FunctionCell adhesion
Function & Pathway6
Protein Function (2)
- CD markers
- Transporters:Accessory Factors Involved in Transport
Cellular Component (8)
Molecular Function (3)
Biological Process (3)
Mediation Categories (2)
Fusion and delivery mediationImmune mediation
Relations & Evidence40
Ligand-Receptor Signaling (39)
39 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | TopDB | No | No | No | Yes | No |
| transmembrane | transmembrane | LOCATE | No | No | No | Yes | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | Yes | No |
| transmembrane | transmembrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | Cellinker | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | HPMR | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | No | No | No | Yes | No |
| cell_surface | cell_surface | Surfaceome | No | No | No | Yes | No |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 24670152 |
Sequence, Structure & Domains9
Sequences
Length
219
Mass
24,341
Sequence
MGMSSLKLLKYVLFFFNLLFWICGCCILGFGIYLLIHNNFGVLFHNLPSLTLGNVFVIVGSIIMVVAFLGCMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHSNFLYIGIITICVCVIEVLGMSFALTLNCQIDKTSQTIGL
3D Structural Models
Turn
124..127
Helix
9..37; 52..76; 79..105; 107..123; 129..142; 150..152; 170..180; 182..208
Beta Strand
146..149; 159..161
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Protein Families
Tetraspanin (TM4SF) family
Sequence Similarities
Belongs to the tetraspanin (TM4SF) family.
Clinical Relevance1
Antibody
Supporting Publications9
| PMID | Title | Abstract |
|---|---|---|
| 30915084 | Extracellular Vesicles Mediate Mesenchymal Stromal Cell-Dependent Regulation of B Cell PI3K-AKT Signaling Pathway and Actin Cytoskeleton. | No abstract available |
| 31382537 | An Insight into the Proteome of Uveal Melanoma-Derived Ectosomes Reveals the Presence of Potentially Useful Biomarkers. | No abstract available |
| 31805958 | Proteomic analysis of cerebrospinal fluid extracellular vesicles reveals synaptic injury, inflammation, and stress response markers in HIV patients with cognitive impairment. | No abstract available |
| 32560723 | T2 and T17 cytokines alter the cargo and function of airway epithelium-derived extracellular vesicles. | No abstract available |
| 37563857 | Comprehensive characterization of human brain-derived extracellular vesicles using multiple isolation methods: Implications for diagnostic and therapeutic applications. | No abstract available |
| 38113368 | In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum. | No abstract available |
| 38207106 | Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity. | No abstract available |
| 40189497 | Small extracellular vesicle-based one-step high-throughput microfluidic platform for epithelial ovarian cancer diagnosis. | No abstract available |
| 40985879 | TurboID-Mediated Profiling of Glioblastoma-Derived Extracellular Vesicle Cargo Proteins. | No abstract available |