Protein detail
ELAF
Elafin (Elastase-specific inhibitor) (ESI) (Peptidase inhibitor 3) (PI-3) (Protease inhibitor WAP3) (Skin-derived antileukoproteinase) (SKALP) (WAP four-disulfide core domain protein 14)
Entry name ELAF | UniProt ID | EVMP confidence score 0.60 |
Supporting publications (n) 20 | Transmembrane count | Protein classification Plasma proteinsPredicted secreted proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Elafin (Elastase-specific inhibitor) (ESI) (Peptidase inhibitor 3) (PI-3) (Protease inhibitor WAP3) (Skin-derived antileukoproteinase) (SKALP) (WAP four-disulfide core domain protein 14)
Protein Class (2)
Plasma proteinsPredicted secreted proteins
Protein Function
Predicted secreted proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (6)
cementoinELAFINESISKALPWAP3WFDC14
Gene Description
Peptidase inhibitor 3
Chromosome
20
Position
45174902-45176544
Supporting publications (n)
20
EVMP confidence score
0.60
Fluorescence & Localization2
Tissue Specificskeletal muscleCell SpecificBergmann glia
Function & Pathway6
Protein Function
Predicted secreted proteins
Cellular Component (5)
Molecular Function (3)
Biological Process (3)
Reactome (4)
Mediation Categories
Immune mediation
Relations & Evidence23
Ligand-Receptor Signaling (19)
19 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| secreted_peptidase_inhibitor | secreted_peptidase_inhibitor | OmniPath | No | No | Yes | No | No |
| secreted | secreted | UniProt_keyword | No | No | Yes | No | No |
| secreted | secreted | UniProt_location | No | No | Yes | No | No |
| secreted | secreted | HPA_secretome | No | No | Yes | No | No |
| secreted | secreted | OmniPath | No | No | Yes | No | No |
| ligand | ligand | iTALK | Yes | No | Yes | No | No |
| ligand | ligand | CellTalkDB | Yes | No | Yes | No | No |
| ligand | ligand | Guide2Pharma | Yes | No | Yes | No | No |
| ligand | ligand | OmniPath | Yes | No | Yes | No | No |
Page 2 of 2Previous
Protein Complex Composition (3)
3 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| CSTADSPEVPLIVLKRT1KRT5LORICRINPI3SPRR3 | P01040P04264P07476P13647P15924P19957P23490Q92817Q9UBC9 | 1:1:1:1:1:1:1:1:1 | CompleatCFinder | Compleat:HC7996 | ||
| CSTADSPEVPLIVLKRT1LORICRINPI3 | P01040P04264P07476P15924P19957P23490Q92817 | 1:1:1:1:1:1:1 | CompleatCFinder | Compleat:HC6364 | ||
| PI3 | P19957 | 18 | PDB | PDB:6atu |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion Chromatography | Mass spectrometry | 1 | 38576002 |
Sequence, Structure & Domains10
Sequences
Length
117
Mass
12,270
Sequence
MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
3D Structural Models
Helix
95..97
Beta Strand
65..69; 73..75; 81..84; 98..101; 103..106; 108..114
3D Structure
NMR spectroscopy (1); X-ray crystallography (2)
Domain & Motif Annotations
Repeat
29..54; SVP-1 clotting 1; 55..72; SVP-1 clotting 2
Domain (CC)
Consists of two domains: the transglutaminase substrate domain (cementoin moiety) and the elastase inhibitor domain. The transglutaminase substrate domain serves as an anchor to localize elafin covalently to specific sites on extracellular matrix proteins.
Domain (FT)
69..117; WAP
Region
29..72; 2 X tandem repeats of SVP-1 like motif
Clinical Relevance2
Drugs
Supporting Publications20
| PMID | Title | Abstract |
|---|---|---|
| 27312428 | A novel TP53 pathway influences the HGS-mediated exosome formation in colorectal cancer. | No abstract available |
| 27723984 | Proteomic and Bioinformatic Characterization of Extracellular Vesicles Released from Human Macrophages upon Influenza A Virus Infection. | No abstract available |
| 30760538 | Microvesicle Proteomic Profiling of Uterine Liquid Biopsy for Ovarian Cancer Early Detection. | No abstract available |
| 31320591 | Exosomes regulate neurogenesis and circuit assembly. | No abstract available |
| 31508500 | Proteomic profiling of extracellular vesicles allows for human breast cancer subtyping. | No abstract available |
| 32795414 | Extracellular Vesicle and Particle Biomarkers Define Multiple Human Cancers. | Among traditional exosome markers, CD9, HSPA8, ALIX, and HSP90AB1 represent pan-EVP markers, while ACTB, MSN, and RAP1B are novel pan-EVP markers. |
| 33709510 | Unbiased proteomic profiling of host cell extracellular vesicle composition and dynamics upon HIV-1 infection. | No abstract available |
| 34186243 | A Reductionist Approach Using Primary and Metastatic Cell-Derived Extracellular Vesicles Reveals Hub Proteins Associated with Oral Cancer Prognosis. | No abstract available |
| 37686366 | Identification of a Non-Invasive Urinary Exosomal Biomarker for Diabetic Nephropathy Using Data-Independent Acquisition Proteomics. | No abstract available |
| 38225453 | Deep proteomic analysis of obstetric antiphospholipid syndrome by DIA-MS of extracellular vesicle enriched fractions. | No abstract available |
Page 1 of 2Next