Protein detail
DPA1
HLA class II histocompatibility antigen, DP alpha 1 chain (DP(W3)) (DP(W4)) (HLA-SB alpha chain) (MHC class II DP3-alpha) (MHC class II DPA1)
Protein symbol DPA1 | UniProt ID | EVMP score 0.25 |
Frequency 1 | Transmembrane count 1 | Protein classification Human disease related genesPredicted intracellular proteinsPredicted membrane proteins |
Basic Information
Protein Names
HLA class II histocompatibility antigen, DP alpha 1 chain (DP(W3)) (DP(W4)) (HLA-SB alpha chain) (MHC class II DP3-alpha) (MHC class II DPA1)
Protein Class
Human disease related genesPredicted intracellular proteinsPredicted membrane proteins
Protein Function
- Human disease related genes:Immune system diseases:Allergies and autoimmune diseases
- Human disease related genes:Cardiovascular diseases:Cardiac diseases
- Human disease related genes:Skin diseases:Skin and soft tissue diseases
- Predicted intracellular proteins
Transmembrane
223..245; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
HLA-DP1A
Gene Description
Major histocompatibility complex, class II, DP alpha 1
Chromosome
6
Position
33064569-33080775
Frequency
1
EVMP Score
0.25
Fluorescence & Localization
Function & Pathway
Protein Function
- Human disease related genes:Immune system diseases:Allergies and autoimmune diseases
- Human disease related genes:Cardiovascular diseases:Cardiac diseases
- Human disease related genes:Skin diseases:Skin and soft tissue diseases
- Predicted intracellular proteins
Cellular Component
- GO:0000139 Golgi membrane
- GO:0005765 lysosomal membrane
- GO:0005886 plasma membrane
- GO:0009986 cell surface
- GO:0012507 ER to Golgi transport vesicle membrane
- GO:0030658 transport vesicle membrane
- GO:0030666 endocytic vesicle membrane
- GO:0030669 clathrin-coated endocytic vesicle membrane
- GO:0031902 late endosome membrane
- GO:0032588 trans-Golgi network membrane
- GO:0042613 MHC class II protein complex
- GO:0043231 intracellular membrane-bounded organelle
- GO:0098553 lumenal side of endoplasmic reticulum membrane
Molecular Function
Biological Process
- GO:1904282 regulation of antigen processing and presentation of endogenous peptide antigen via MHC class I
- GO:1904283 negative regulation of antigen processing and presentation of endogenous peptide antigen via MHC class I
- GO:0002589 regulation of antigen processing and presentation of peptide antigen via MHC class I
KEGG
- hsa04145 Phagosome
- KEGG:hsa04514 Cell adhesion molecule (CAM) interaction
- KEGG:hsa04612 Antigen processing and presentation
- KEGG:hsa04640 Hematopoietic cell lineage
- KEGG:hsa04658 Th1 and Th2 cell differentiation
- KEGG:hsa04659 Th17 cell differentiation
- KEGG:hsa04672 Intestinal immune network for IgA production
- KEGG:hsa04940 Type I diabetes mellitus
- KEGG:hsa05140 Leishmaniasis
- KEGG:hsa05145 Toxoplasmosis
- KEGG:hsa05150 Staphylococcus aureus infection
- KEGG:hsa05152 Tuberculosis
- KEGG:hsa05164 Influenza A
- KEGG:hsa05166 Human T-cell leukemia virus 1 infection
- KEGG:hsa05168 Herpes simplex virus 1 infection
- KEGG:hsa05169 Epstein-Barr virus infection
- KEGG:hsa05310 Asthma
- KEGG:hsa05320 Autoimmune thyroid disease
- KEGG:hsa05321 Inflammatory bowel disease
- KEGG:hsa05322 Systemic lupus erythematosus
- KEGG:hsa05323 Rheumatoid arthritis
- KEGG:hsa05330 Allograft rejection
- KEGG:hsa05332 Graft-versus-host disease
- KEGG:hsa05416 Viral myocarditis
Reactome
- R-hsa-1280218 adaptive immune system
- R-hsa-389948 co inhibition by pd 1
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-202424 downstream tcr signaling
- R-hsa-202433 generation of second messenger molecules
- R-hsa-877300 interferon gamma signaling
- R-hsa-913531 interferon signaling
- R-hsa-2132295 mhc class ii antigen presentation
- R-hsa-202427 phosphorylation of cd3 and tcr zeta chains
- R-hsa-388841 regulation of t cell activation by cd28 family
- R-hsa-202403 tcr signaling
Mediation Categories
Adhesion and uptake mediationFusion and delivery mediationImmune mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
35 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | CellCellInteractions | No | Yes | No | Yes | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | Yes | No |
| transmembrane_phobius | transmembrane_predicted | Almen2009 | No | No | No | Yes | No |
| transmembrane_sosui | transmembrane_predicted | Almen2009 | No | No | No | Yes | No |
| transmembrane_tmhmm | transmembrane_predicted | Almen2009 | No | No | No | Yes | No |
Page 4 of 4Previous
Regulatory Interaction Network
0 records.
Protein Complex Composition
11 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| Class II MHC | HLA-DPA1HLA-DQB1 | P01920P20036 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C428 | |
| Class II MHC | HLA-DPA1HLA-DQB2 | P05538P20036 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C428 | |
| Class II MHC | HLA-DOBHLA-DPA1 | P13765P20036 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C428 | |
| Class II MHC | HLA-DMBHLA-DPA1 | P20036P28068 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C428 | |
| Class II MHC:Antigen | CHEBI:166824CHEBI:53000HLA-DPA1HLA-DQB1 | CHEBI:166824CHEBI:53000P01920P20036 | 0:0:0:0 | SIGNOR | SIGNOR:SIGNOR-C429 | |
| Class II MHC:Antigen | CHEBI:166824CHEBI:53000HLA-DPA1HLA-DQB2 | CHEBI:166824CHEBI:53000P05538P20036 | 0:0:0:0 | SIGNOR | SIGNOR:SIGNOR-C429 | |
| Class II MHC:Antigen | CHEBI:166824CHEBI:53000HLA-DOBHLA-DPA1 | CHEBI:166824CHEBI:53000P13765P20036 | 0:0:0:0 | SIGNOR | SIGNOR:SIGNOR-C429 | |
| Class II MHC:Antigen | CHEBI:166824CHEBI:53000HLA-DMBHLA-DPA1 | CHEBI:166824CHEBI:53000P20036P28068 | 0:0:0:0 | SIGNOR | SIGNOR:SIGNOR-C429 | |
| APOEATP13A2HLA-DPA1NOB1PNO1 | P02649P20036Q9NQ11Q9NRX1Q9ULX3 | 0:0:0:0:0 | hu.MAP2 | |||
| DCBLD1FUT4HLA-DPA1HS3ST3B1 | P20036P22083Q8N8Z6Q9Y662 | 0:0:0:0 | hu.MAP |
Page 1 of 2Next
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 38795909 |
Sequence, Structure & Domains
Sequences
Length
260
Mass
29,381
Sequence
MRPEDRMFHIRAVILRALSLAFLLSLRGAGAIKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGTL
3D Structural Models
Turn
67..70
Helix
77..82; 87..107
Beta Strand
35..49; 51..57; 60..66; 71..76; 119..126; 134..146; 149..154; 157..159; 161..165; 176..184; 191..197; 201..203; 205..210
3D Structure
X-ray crystallography (10)
Domain & Motif Annotations
Domain (FT)
118..210; Ig-like C1-type
Region
29..115; Alpha-1; 116..209; Alpha-2; 210..222; Connecting peptide
Protein Families
MHC class II family
Sequence Similarities
Belongs to the MHC class II family.
Clinical Relevance
Antibody
Interaction Protein
ENSG00000157637
Interaction Count
1
Interaction Dataset
biogrid_bioplex