Protein detail
ANPRB
Atrial natriuretic peptide receptor 2 (EC 4.6.1.2) (Atrial natriuretic peptide receptor type B) (ANP-B) (ANPR-B) (NPR-B) (Guanylate cyclase B) (GC-B)
Entry name ANPRB | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 7 | Transmembrane count 1 | Protein classification |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Atrial natriuretic peptide receptor 2 (EC 4.6.1.2) (Atrial natriuretic peptide receptor type B) (ANP-B) (ANPR-B) (NPR-B) (Guanylate cyclase B) (GC-B)
Protein Function (9)
- Predicted intracellular proteins
- Human disease related genes:Congenital malformations:Congenital malformations of the musculoskeletal system
- Kinases:RGC receptor guanylate cyclase kinases
- ENZYME proteins:Lyases
- Enzymes
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
- FDA approved drug targets:Small molecule drugs
- FDA approved drug targets:Biotech drugs
Transmembrane
459..478; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Supporting publications (n)
7
EVMP confidence score
0.50
Fluorescence & Localization
Cell SpecificChoroid plexus epithelial cellsSingle-Nuclei Brain Specificchoroid plexus epithelial cellBlood Cell Specificplasmacytoid DC
Function & Pathway
Protein Function (9)
- Predicted intracellular proteins
- Human disease related genes:Congenital malformations:Congenital malformations of the musculoskeletal system
- Kinases:RGC receptor guanylate cyclase kinases
- ENZYME proteins:Lyases
- Enzymes
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
- FDA approved drug targets:Small molecule drugs
- FDA approved drug targets:Biotech drugs
Cellular Component (6)
Molecular Function (9)
Biological Process (3)
KEGG (6)
Reactome (3)
Mediation Categories (2)
Immune mediationReceptor-signaling mediation
Relations & Evidence55
Enzyme-Mediated Modification (3)
3 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| NPR2 | CSNK1E | P49674 | S | 526 | phosphorylation | KEA | KEA:17570479 |
| NPR2 | PRKCB | P05771 | S | 518 | phosphorylation | KEA | KEA:17570479 |
| NPR2 | PRKCB | P05771 | T | 516 | phosphorylation | KEA | KEA:17570479 |
Ligand-Receptor Signaling (51)
51 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | HPMR | Yes | Yes | |||
| receptor | receptor | CellChatDB | Yes | Yes | |||
| receptor | receptor | CellTalkDB | Yes | Yes | |||
| receptor | receptor | Surfaceome | Yes | Yes | |||
| receptor | receptor | Ramilowski2015 | Yes | Yes | |||
| receptor | receptor | Guide2Pharma | Yes | Yes | |||
| receptor | receptor | LRdb | Yes | Yes | |||
| receptor | receptor | Baccin2019 | Yes | Yes | |||
| natriuretic_peptide | receptor | OmniPath | Yes | Yes | |||
| kinase | receptor | Almen2009 | Yes | Yes |
Page 1 of 6Next
Sequence, Structure & Domains
Sequences
Length
1,047
Mass
117,022
Sequence
MALPSLLLLVAALAGGVRPPGARNLTLAVVLPEHNLSYAWAWPRVGPAVALAVEALGRALPVDLRFVSSELEGACSEYLAPLSAVDLKLYHDPDLLLGPGCVYPAASVARFASHWRLPLLTAGAVASGFSAKNDHYRTLVRTGPSAPKLGEFVVTLHGHFNWTARAALLYLDARTDDRPHYFTIEGVFEALQGSNLSVQHQVYAREPGGPEQATHFIRANGRIVYICGPLEMLHEILLQAQRENLTNGDYVFFYLDVFGESLRAGPTRATGRPWQDNRTREQAQALREAFQTVLVITYREPPNPEYQEFQNRLLIRAREDFGVELGPSLMNLIAGCFYDGILLYAEVLNETIQEGGTREDGLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGDLDSGDFQPAAHYSGAEKQIWWTGRPIPWVKGAPPSDNPPCAFDLDDPSCDKTPLSTLAIVALGTGITFIMFGVSSFLIFRKLMLEKELASMLWRIRWEELQFGNSERYHKGAGSRLTLSLRGSSYGSLMTAHGKYQIFANTGHFKGNVVAIKHVNKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLASFRSTAEPDDSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFGIILQEIALRSGPFYLEGLDLSPKEIVQKVRNGQRPYFRPSIDRTQLNEELVLLMERCWAQDPAERPDFGQIKGFIRRFNKEGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGERKGPPGLL
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=Long; IsoId=P20594-1; Sequence=Displayed; Name=Short; Synonyms=NPR-BI; IsoId=P20594-2; Sequence=VSP_001810
Alternative Sequence
964..1047; PVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGERKGPPGLL -> KADSHSSPSLHLSQTLPTCFFSKGQSVLGLLA (in isoform Short)
Domain & Motif Annotations
Domain (FT)
513..786; Protein kinase; 861..991; Guanylate cyclase
Protein Families
Adenylyl cyclase class-4/guanylyl cyclase family
Sequence Similarities
Belongs to the adenylyl cyclase class-4/guanylyl cyclase family.
Supporting Publications7
| PMID | Title | Related sentences |
|---|---|---|
| 33304478 | The proteomic landscape of small urinary extracellular vesicles during kidney transplantation. | No related sentences available |
| 35399949 | Integration of Metabolomics and Proteomics in Exploring the Endothelial Dysfunction Mechanism Induced by Serum Exosomes From Diabetic Retinopathy and Diabetic Nephropathy Patients. | No related sentences available |
| 38113368 | In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum. | No related sentences available |
| 38207106 | Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity. | No related sentences available |
| 38716512 | Assessment of urine sample collection and processing variables for extracellular vesicle-based proteomics. | No related sentences available |
| 40189497 | Small extracellular vesicle-based one-step high-throughput microfluidic platform for epithelial ovarian cancer diagnosis. | No related sentences available |
| 41307968 | Extracellular Vesicles Define Discrete Nano-Based Niches Within the Human Haematopoietic System. | No related sentences available |