Protein detail

ANPRB

Atrial natriuretic peptide receptor 2 (EC 4.6.1.2) (Atrial natriuretic peptide receptor type B) (ANP-B) (ANPR-B) (NPR-B) (Guanylate cyclase B) (GC-B)

Entry name ANPRB	UniProt ID P20594	EVMP confidence score 0.38
Supporting publications (n) 7	Transmembrane count 1	Protein classification

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information8

Protein Names

Atrial natriuretic peptide receptor 2 (EC 4.6.1.2) (Atrial natriuretic peptide receptor type B) (ANP-B) (ANPR-B) (NPR-B) (Guanylate cyclase B) (GC-B)

Protein Function (9)

Predicted intracellular proteins
Human disease related genes:Congenital malformations:Congenital malformations of the musculoskeletal system
Kinases:RGC receptor guanylate cyclase kinases
ENZYME proteins:Lyases
Enzymes
Transporters:Accessory Factors Involved in Transport
Disease related genes
FDA approved drug targets:Small molecule drugs
FDA approved drug targets:Biotech drugs

Transmembrane

459..478; Helical

Transmembrane Count

Ensembl

ENSG00000159899

Entrez Gene Symbol

NPR2

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization3

Cell SpecificChoroid plexus epithelial cellsSingle-Nuclei Brain Specificchoroid plexus epithelial cellBlood Cell Specificplasmacytoid DC

Function & Pathway7

Protein Function (9)

Predicted intracellular proteins
Human disease related genes:Congenital malformations:Congenital malformations of the musculoskeletal system
Kinases:RGC receptor guanylate cyclase kinases
ENZYME proteins:Lyases
Enzymes
Transporters:Accessory Factors Involved in Transport
Disease related genes
FDA approved drug targets:Small molecule drugs
FDA approved drug targets:Biotech drugs

Cellular Component (6)

Molecular Function (9)

Biological Process (3)

KEGG (6)

Reactome (3)

Mediation Categories (2)

Immune mediationReceptor-signaling mediation

Relations & Evidence55

Enzyme-Mediated Modification (3)

3 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
NPR2	CSNK1E	P49674	S	526	phosphorylation	KEA	KEA:17570479
NPR2	PRKCB	P05771	S	518	phosphorylation	KEA	KEA:17570479
NPR2	PRKCB	P05771	T	516	phosphorylation	KEA	KEA:17570479

Ligand-Receptor Signaling (51)

51 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
cell_adhesion	cell_adhesion	Cellinker	Yes	Yes	No	Yes	No
adhesion	adhesion	OmniPath	Yes	Yes	No	Yes	No
cell_adhesion	cell_adhesion	OmniPath	Yes	Yes	No	Yes	No
transmembrane	transmembrane	UniProt_location	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_topology	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_keyword	No	No	No	Yes	No
transmembrane_predicted	transmembrane	OmniPath	No	No	No	Yes	No
transmembrane	transmembrane	Ramilowski_location	No	No	No	Yes	No
transmembrane	transmembrane	OmniPath	No	No	No	Yes	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	No	Yes	No

Page 3 of 6Previous Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	2	38343172 40222457

Sequence, Structure & Domains8

Sequences

Length

1,047

Mass

117,022

Sequence

MALPSLLLLVAALAGGVRPPGARNLTLAVVLPEHNLSYAWAWPRVGPAVALAVEALGRALPVDLRFVSSELEGACSEYLAPLSAVDLKLYHDPDLLLGPGCVYPAASVARFASHWRLPLLTAGAVASGFSAKNDHYRTLVRTGPSAPKLGEFVVTLHGHFNWTARAALLYLDARTDDRPHYFTIEGVFEALQGSNLSVQHQVYAREPGGPEQATHFIRANGRIVYICGPLEMLHEILLQAQRENLTNGDYVFFYLDVFGESLRAGPTRATGRPWQDNRTREQAQALREAFQTVLVITYREPPNPEYQEFQNRLLIRAREDFGVELGPSLMNLIAGCFYDGILLYAEVLNETIQEGGTREDGLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGDLDSGDFQPAAHYSGAEKQIWWTGRPIPWVKGAPPSDNPPCAFDLDDPSCDKTPLSTLAIVALGTGITFIMFGVSSFLIFRKLMLEKELASMLWRIRWEELQFGNSERYHKGAGSRLTLSLRGSSYGSLMTAHGKYQIFANTGHFKGNVVAIKHVNKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLASFRSTAEPDDSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFGIILQEIALRSGPFYLEGLDLSPKEIVQKVRNGQRPYFRPSIDRTQLNEELVLLMERCWAQDPAERPDFGQIKGFIRRFNKEGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGERKGPPGLL

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=Long; IsoId=P20594-1; Sequence=Displayed; Name=Short; Synonyms=NPR-BI; IsoId=P20594-2; Sequence=VSP_001810

Alternative Sequence

964..1047; PVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGERKGPPGLL -> KADSHSSPSLHLSQTLPTCFFSKGQSVLGLLA (in isoform Short)

Domain & Motif Annotations

Domain (FT)

513..786; Protein kinase; 861..991; Guanylate cyclase

Protein Families

Adenylyl cyclase class-4/guanylyl cyclase family

Sequence Similarities

Belongs to the adenylyl cyclase class-4/guanylyl cyclase family.

Supporting Publications7

PMID	Title	Abstract
33304478	The proteomic landscape of small urinary extracellular vesicles during kidney transplantation.	No abstract available
35399949	Integration of Metabolomics and Proteomics in Exploring the Endothelial Dysfunction Mechanism Induced by Serum Exosomes From Diabetic Retinopathy and Diabetic Nephropathy Patients.	No abstract available
38113368	In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum.	No abstract available
38207106	Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity.	No abstract available
38716512	Assessment of urine sample collection and processing variables for extracellular vesicle-based proteomics.	No abstract available
40189497	Small extracellular vesicle-based one-step high-throughput microfluidic platform for epithelial ovarian cancer diagnosis.	No abstract available
41307968	Extracellular Vesicles Define Discrete Nano-Based Niches Within the Human Haematopoietic System.	No abstract available