Protein detail

ITAL

Integrin alpha-L (CD11 antigen-like family member A) (Leukocyte adhesion glycoprotein LFA-1 alpha chain) (LFA-1A) (Leukocyte function-associated molecule 1 alpha chain) (CD antigen CD11a)

Entry name ITAL	UniProt ID P20701	EVMP confidence score 0.25
Supporting publications (n) 3	Transmembrane count 1	Protein classification CD markersFDA approved drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Integrin alpha-L (CD11 antigen-like family member A) (Leukocyte adhesion glycoprotein LFA-1 alpha chain) (LFA-1A) (Leukocyte function-associated molecule 1 alpha chain) (CD antigen CD11a)

Protein Class (5)

CD markersFDA approved drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters

Protein Function (5)

Predicted intracellular proteins
CD markers
Transporters:Accessory Factors Involved in Transport
FDA approved drug targets:Small molecule drugs
FDA approved drug targets:Biotech drugs

Transmembrane

1091..1111; Helical

Transmembrane Count

Ensembl

ENSG00000005844

Entrez Gene Symbol

ITGAL

Gene Synonym (3)

CD11ALFA-1LFA1A

Gene Description

Integrin subunit alpha L

Chromosome

Position

30472658-30523567

Supporting publications (n)

EVMP confidence score

0.25

Fluorescence & Localization5

Tissue SpecificintestineCell SpecificAstrocytesSingle-Nuclei Brain SpecificleukocyteSecretome LocationIntracellular and membraneSecretome FunctionNo annotated function

Function & Pathway7

Protein Function (5)

Predicted intracellular proteins
CD markers
Transporters:Accessory Factors Involved in Transport
FDA approved drug targets:Small molecule drugs
FDA approved drug targets:Biotech drugs

Cellular Component (8)

Molecular Function (5)

Biological Process (3)

KEGG (14)

Page 1 of 2

Reactome (11)

Page 1 of 2

Mediation Categories (4)

Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediation

Relations & Evidence69

Ligand-Receptor Signaling (63)

63 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
cell_adhesion	cell_adhesion	OmniPath	Yes	Yes	No	Yes	No
matrix_adhesion	matrix_adhesion	OmniPath	No	Yes	No	Yes	No
transmembrane	transmembrane	UniProt_location	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_topology	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_keyword	No	No	No	Yes	No
transmembrane_predicted	transmembrane	OmniPath	No	No	No	Yes	No
transmembrane	transmembrane	GO_Intercell	No	No	No	Yes	No
transmembrane	transmembrane	CellPhoneDB	No	No	No	Yes	No
transmembrane	transmembrane	TopDB	No	No	No	Yes	No
transmembrane	transmembrane	LOCATE	No	No	No	Yes	No

Page 4 of 7Previous Next

Regulatory Interaction Network (4)

4 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
SRC	P12931	ITAL	P20701	Yes	Yes	Yes	SIGNOR	SIGNOR:25624455
JAK2	O60674	ITAL	P20701	Yes	Yes	No	SIGNOR	SIGNOR:25624455
ITAL	P20701	ICAM1	P05362	Yes	Yes	No	HPMRWangCellPhoneDBSIGNORHINTBioGRIDIntActDIPSPIKE_LCLit-BM-17	HINT:11279101 SIGNOR:23994464 Lit-BM-17:11279101 BioGRID:12526797 HINT:12208882 IntAct:12526797 HPMR:16354667 IntAct:16595626 DIP:16595626 Lit-BM-17:12526797 HPMR:14507735 BioGRID:11786177 HINT:12526797 HINT:29997244 Lit-BM-17:11786177 HINT:16595626 HINT:11786177 HINT:22956999 SPIKE_LC:16189514
ITAL	P20701	AKAP9	Q99996	Yes	Yes	No	SIGNOR	SIGNOR:16339516

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	ITGAL	P20701	2	PDB	PDB:3f74PDB:3bqnPDB:3eoaPDB:1zooPDB:7kc5PDB:7kc6PDB:1xuoPDB:3bqmPDB:1xddPDB:1lfaPDB:3eobPDB:3e2mPDB:1rd4PDB:1cqpPDB:3hi6PDB:1xdgPDB:1zopPDB:3f78

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometryWestern blottingFlow cytometryELISA	6	37507836 38225453 25471207 30760538 40311616 40091455

Sequence, Structure & Domains17

Sequences

Length

1,170

Mass

128,770

Sequence

MKDSCITVMAMALLSGFFFFAPASSYNLDVRGARSFSPPRAGRHFGYRVLQVGNGVIVGAPGEGNSTGSLYQCQSGTGHCLPVTLRGSNYTSKYLGMTLATDPTDGSILACDPGLSRTCDQNTYLSGLCYLFRQNLQGPMLQGRPGFQECIKGNVDLVFLFDGSMSLQPDEFQKILDFMKDVMKKLSNTSYQFAAVQFSTSYKTEFDFSDYVKRKDPDALLKHVKHMLLLTNTFGAINYVATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETLHKFASKPASEFVKILDTFEKLKDLFTELQKKIYVIEGTSKQDLTSFNMELSSSGISADLSRGHAVVGAVGAKDWAGGFLDLKADLQDDTFIGNEPLTPEVRAGYLGYTVTWLPSRQKTSLLASGAPRYQHMGRVLLFQEPQGGGHWSQVQTIHGTQIGSYFGGELCGVDVDQDGETELLLIGAPLFYGEQRGGRVFIYQRRQLGFEEVSELQGDPGYPLGRFGEAITALTDINGDGLVDVAVGAPLEEQGAVYIFNGRHGGLSPQPSQRIEGTQVLSGIQWFGRSIHGVKDLEGDGLADVAVGAESQMIVLSSRPVVDMVTLMSFSPAEIPVHEVECSYSTSNKMKEGVNITICFQIKSLIPQFQGRLVANLTYTLQLDGHRTRRRGLFPGGRHELRRNIAVTTSMSCTDFSFHFPVCVQDLISPINVSLNFSLWEEEGTPRDQRAQGKDIPPILRPSLHSETWEIPFEKNCGEDKKCEANLRVSFSPARSRALRLTAFASLSVELSLSNLEEDAYWVQLDLHFPPGLSFRKVEMLKPHSQIPVSCEELPEESRLLSRALSCNVSSPIFKAGHSVALQMMFNTLVNSSWGDSVELHANVTCNNEDSDLLEDNSATTIIPILYPINILIQDQEDSTLYVSFTPKGPKIHQVKHMYQVRIQPSIHDHNIPTLEAVVGVPQPPSEGPITHQWSVQMEPPVPCHYEDLERLPDAAEPCLPGALFRCPVVFRQEILVQVIGTLELVGEIEASSMFSLCSSLSISFNSSKHFHLYGSNASLAQVVMKVDVVYEKQMLYLYVLSGIGGLLLLLLIFIVLYKVGFFKRNLKEKMEAGRGVPNGIPAEDSEQLASGQEAGDPGCLKPLHEKDSESGGGKD

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P20701-1; Sequence=Displayed; Name=2; IsoId=P20701-2; Sequence=VSP_002738; Name=3; IsoId=P20701-3; Sequence=VSP_042842, VSP_042843

Alternative Sequence

110..192; Missing (in isoform 3); 746; Missing (in isoform 3); 954; Q -> QGVHGLVEMQTSKQILCRPAGDAEHTVGAQEGELPCPWGVSEAFRDNIRAGPCR (in isoform 2)

3D Structural Models

Turn

43..46; 75..77; 93..96; 103..105; 186..188; 398..401; 1082..1086; 1124..1127

Helix

30..32; 169..185; 208..214; 217..221; 233..243; 247..249; 274..276; 288..290; 293..297; 298..302; 307..310; 317..319; 323..330; 370..373; 427..429; 571..574; 1090..1114; 1118..1123; 1137..1147; 1153..1155; 1156..1165; 1167..1170

Beta Strand

34..36; 47..52; 55..60; 69..73; 80..82; 97..101; 108..119; 122..134; 140..143; 155..162; 189..206; 255..265; 279..287; 311..316; 331..333; 352..359; 362..367; 375..380; 387..391; 406..411; 413..416; 419..424; 432..437; 446..452; 462..467; 472..474; 477..482; 493..499; 501..510; 514..516; 523..527; 531..535; 539..543; 549..554; 558..561; 566..570; 583..589; 593..595; 598..603; 606..612

3D Structure

NMR spectroscopy (3); X-ray crystallography (38)

Domain & Motif Annotations

Compositional Bias

1157..1170; Basic and acidic residues

Repeat

31..82; FG-GAP 1; 83..141; FG-GAP 2; 338..389; FG-GAP 3; 390..445; FG-GAP 4; 446..506; FG-GAP 5; 507..563; FG-GAP 6; 567..627; FG-GAP 7

Motif

1115..1119; GFFKR motif

Domain (CC)

The integrin I-domain (insert) is a VWFA domain (PubMed:2537322). Integrins with I-domains do not undergo protease cleavage. The I-domain is necessary and sufficient for interaction with ICAM1 and F11R (PubMed:15528364).

Domain (FT)

156..327; VWFA

Region

1128..1170; Disordered

Protein Families

Integrin alpha chain family

Sequence Similarities

Belongs to the integrin alpha chain family.

Clinical Relevance9

Disease Involvement

FDA approved drug targets

Related Diseases (6)

Conjunctiva disorder Diabetes mellitus Human immunodeficiency virus disease Psoriasis Transplant rejection Visual system disease

Biomarker

Phase 3; Investigative; Preclinical; Approved; Phase 2

Drug Targets

FDA approved drug targets

Antibody

CAB025011

Interaction Protein (2)

ENSG00000081237ENSG00000090339

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications3

PMID	Title	Abstract
38113368	In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum.	No abstract available
38207106	Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity.	No abstract available
41068253	Identification of plasma extracellular vesicle protein biomarkers in diabetic retinopathy progression.	No abstract available