Protein detail
NK2R
Substance-K receptor (SKR) (NK-2 receptor) (NK-2R) (Neurokinin A receptor) (Tachykinin receptor 2)
Entry name NK2R | UniProt ID | EVMP confidence score 0.28 |
Supporting publications (n) 1 | Transmembrane count 7 | Protein classification |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Substance-K receptor (SKR) (NK-2 receptor) (NK-2R) (Neurokinin A receptor) (Tachykinin receptor 2)
Protein Function
G-protein coupled receptors:GPCRs excl olfactory receptors
Transmembrane
33..56; Helical; Name=1; 70..90; Helical; Name=2; 108..129; Helical; Name=3; 150..170; Helical; Name=4; 197..218; Helical; Name=5; 252..272; Helical; Name=6; 291..310; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Supporting publications (n)
1
EVMP confidence score
0.28
Fluorescence & Localization
Tissue Specificlymphoid tissueCell SpecificDifferentiating spermatogoniaSingle-Nuclei Brain Specificupper rhombic lip
Function & Pathway
Protein Function
G-protein coupled receptors:GPCRs excl olfactory receptors
Cellular Component (4)
Molecular Function (3)
Biological Process (3)
KEGG (3)
Reactome (6)
Mediation Categories (3)
Clinical-translation mediationFusion and delivery mediationReceptor-signaling mediation
Relations & Evidence58
Ligand-Receptor Signaling (52)
52 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | LOCATE | Yes | ||||
| transmembrane | transmembrane | Ramilowski_location | Yes | ||||
| transmembrane | transmembrane | OmniPath | Yes | ||||
| plasma_membrane | plasma_membrane | UniProt_location | Yes | ||||
| plasma_membrane | plasma_membrane | Cellinker | Yes | ||||
| plasma_membrane | plasma_membrane | OmniPath | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | HPMR | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | Yes | ||||
| cell_surface | cell_surface | Surfaceome | Yes | ||||
| cell_surface | cell_surface | connectomeDB2020 | Yes |
Regulatory Interaction Network (5)
5 records.
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometryMass spectrometry|FACSFACSWestern blottingMass spectrometry [LTQ-FT Ultra]Mass spectrometry [QTOF]R SequencingWestern blotting|Flow cytometryFlow cytometry | 3 | 188029203861238539166055 |
Sequence, Structure & Domains
Sequences
Length
398
Mass
44,442
Sequence
MGTCDIVTEANISSGPESNTTGITAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILAHRRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVSIYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAGIWLVALALASPQCFYSTVTMDQGATKCVVAWPEDSGGKTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLWRRAVPGHQAHGANLRHLQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYLALFWLAMSSTMYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMAGDTAPSEATSGEAGRPQDGSGLWFGYGLLAPTKTHVEI
3D Structural Models
Turn
48..51; 67..69; 109..111; 145..148; 239..241
Helix
30..47; 52..59; 70..85; 89..95; 105..108; 112..122; 124..130; 132..135; 149..162; 164..167; 193..196; 198..204; 207..225; 242..260; 264..267; 268..270; 285..294; 296..298; 299..309
Beta Strand
175..178; 282..284; 310..312
3D Structure
Electron microscopy (1)
Domain & Motif Annotations
Protein Families
G-protein coupled receptor 1 family
Sequence Similarities
Belongs to the G-protein coupled receptor 1 family.
Clinical Relevance
Related Diseases (12)
Biomarker
Discontinued in Phase 1; Discontinued in Phase 3; Discontinued in Phase 2; Phase 2; Phase 1/2; Phase 3; Terminated
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 35611462 | Extracellular vesicles expressing CEACAM proteins in the urine of bladder cancer patients. | No related sentences available |