Protein detail
S1PR1
Sphingosine 1-phosphate receptor 1 (S1P receptor 1) (S1P1) (Endothelial differentiation G-protein coupled receptor 1) (Sphingosine 1-phosphate receptor Edg-1) (S1P receptor Edg-1) (CD antigen CD363)
Entry name S1PR1 | UniProt ID | EVMP confidence score 0.25 |
Supporting publications (n) 1 | Transmembrane count 7 | Protein classification Cancer-related genesCD markersFDA approved drug targetsG-protein coupled receptorsPredicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Sphingosine 1-phosphate receptor 1 (S1P receptor 1) (S1P1) (Endothelial differentiation G-protein coupled receptor 1) (Sphingosine 1-phosphate receptor Edg-1) (S1P receptor Edg-1) (CD antigen CD363)
Protein Class (6)
Cancer-related genesCD markersFDA approved drug targetsG-protein coupled receptorsPredicted membrane proteinsTransporters
Protein Function (6)
- G-protein coupled receptors:Lysolipids receptors
- Transporters
- CD markers
- Cancer-related genes:Candidate cancer biomarkers
- G-protein coupled receptors:GPCRs excl olfactory receptors
- FDA approved drug targets:Small molecule drugs
Transmembrane
47..68; Helical; Name=1; 83..104; Helical; Name=2; 117..138; Helical; Name=3; 161..182; Helical; Name=4; 197..224; Helical; Name=5; 258..278; Helical; Name=6; 290..310; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
CD363D1S3362edg-1EDG1
Gene Description
Sphingosine-1-phosphate receptor 1
Chromosome
1
Position
101236865-101243713
Supporting publications (n)
1
EVMP confidence score
0.25
Fluorescence & Localization6
Tissue SpecificesophagusCell SpecificEsophageal apical cellsSingle-Nuclei Brain Specificcommitted oligodendrocyte precursorSecretome LocationIntracellular and membraneSecretome FunctionTransport
Function & Pathway7
Protein Function (6)
- G-protein coupled receptors:Lysolipids receptors
- Transporters
- CD markers
- Cancer-related genes:Candidate cancer biomarkers
- G-protein coupled receptors:GPCRs excl olfactory receptors
- FDA approved drug targets:Small molecule drugs
Cellular Component (8)
Molecular Function (5)
Biological Process (3)
KEGG (4)
Reactome (11)
- R-hsa-373076 class a 1 rhodopsin like receptors
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-500792 gpcr ligand binding
- R-hsa-5663205 infectious disease
- R-hsa-6785807 interleukin 4 and interleukin 13 signaling
- R-hsa-419408 lysosphingolipid and lpa receptors
- R-hsa-9679191 potential therapeutics for sars
- R-hsa-9679506 sars cov infections
- R-hsa-372790 signaling by gpcr
- R-hsa-449147 signaling by interleukins
Page 1 of 2
Mediation Categories (4)
Clinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence64
Enzyme-Mediated Modification (4)
4 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| S1PR1 | AKT1 | P31749 | T | 236 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDdbPTMKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | KEA:17570479KEA:11583630dbPTM:11583630ProtMapper:11583630HPRD:11583630SIGNOR:11583630 |
| S1PR1 | PDK1 | Q15118 | T | 236 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| S1PR1 | PRKCA | P17252 | T | 236 | phosphorylation | KEA | KEA:17570479 |
| S1PR1 | RPS6KA3 | P51812 | T | 236 | phosphorylation | KEA | KEA:17570479 |
Ligand-Receptor Signaling (52)
52 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | HGNC | No | Yes | No | Yes | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | Yes | No |
Page 6 of 6Previous
Regulatory Interaction Network (6)
6 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| AKT1 | P31749 | S1PR1 | P21453 | Yes | Yes | No | HPRD_MIMPSIGNORProtMapperdbPTMPhosphoSite_KEAHPRDWangPhosphoSite_ProtMapperNetworKIN_KEAHPRD-phosphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetPhosphoPointKEAHPRD_KEASIGNOR_ProtMapperPhosphoSiteSPIKE_LCSPIKE | KEA:17570479KEA:11583630HPRD-phos:11583630dbPTM:11583630SPIKE:11583630PhosphoSite:25588843ProtMapper:11583630SPIKE_LC:11583630PhosphoSite:11583630HPRD:11583630SIGNOR:11583630 |
| S1PR1 | P21453 | GNAI3 | P08754 | Yes | Yes | No | HPRDWangLit-BM-17SIGNOR | Lit-BM-17:8626678HPRD:8626678SIGNOR:31160049 |
| S1PR1 | P21453 | GNAZ | P19086 | Yes | Yes | No | WangSIGNOR | SIGNOR:31160049 |
| ZDHC5 | Q9C0B5 | S1PR1 | P21453 | Yes | Yes | No | SIGNOR | SIGNOR:29185452 |
| S1PR1 | P21453 | GNAO | P09471 | Yes | Yes | No | WangSIGNOR | SIGNOR:31160049 |
| S1PR1 | P21453 | GNAI1 | P63096 | Yes | Yes | No | WangSIGNORHPRDHINTSPIKE_LCLit-BM-17 | SIGNOR:31160049Lit-BM-17:8626678HPRD:8626678HINT:34526663HINT:35412894HINT:37039481HINT:34937912SPIKE_LC:16189514HINT:8626678 |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Protein Organic Solvent Precipitation | Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains11
Sequences
Length
382
Mass
42,811
Sequence
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS
3D Structural Models
Turn
74..77; 109..111; 177..180; 234..236; 284..286
Helix
23..32; 36..39; 48..72; 79..103; 106..108; 114..148; 158..176; 188..190; 200..233; 249..281; 289..291; 294..313; 318..322
Beta Strand
151..153; 183..186; 193..195; 245..248; 314..317
3D Structure
Electron microscopy (15); X-ray crystallography (2)
Domain & Motif Annotations
Compositional Bias
351..366; Basic and acidic residues; 371..382; Polar residues
Region
350..382; Disordered
Protein Families
G-protein coupled receptor 1 family
Sequence Similarities
Belongs to the G-protein coupled receptor 1 family.
Clinical Relevance6
Disease Involvement (2)
Cancer-related genesFDA approved drug targets
Related Diseases (16)
Biomarker
Phase 1; Phase 2; Phase 3; Approved; Investigative; Terminated
Drug Targets
FDA approved drug targets
Drugs (28)
PONESIMODNULLFINGOLIMODFINGOLIMOD LAURYL SULFATEETRASIMODKRP203CENERIMODAMISELIMOD HYDROCHLORIDEOZANIMOD HYDROCHLORIDEASP-4058BMS-986104OZANIMODSIPONIMODFINGOLIMOD HYDROCHLORIDE9,10-PHENANTHRENEQUINONESAR 247799.00CHEMBL:CHEMBL1362503AMISELIMODGSK-2018682CHEMBL:CHEMBL171699SIPONIMOD FUMARATE(S)-FTY720PISOVELLERALCHEMBL:CHEMBL586135CHEMBL:CHEMBL579318SONEPCIZUMABPINAFIDEMOCRAVIMOD HYDROCHLORIDE
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 34265469 | Proteomic Landscape of Exosomes Reveals the Functional Contributions of CD151 in Triple-Negative Breast Cancer. | Furthermore, utilizing quantitative proteomics approach to reveal the proteomes of CD151-deleted exosomes and cells, we found that exosomal CD151 facilitated secretion of ribosomal proteins via exosomes while inhibiting exosome secretion of complement proteins. Moreover, we proved that CD151-deleted exosomes significantly decreased the migration and invasion of TNBC cells. Most importantly, we found that the tetraspanin CD151 expression levels in TNBC-derived serum exosomes were significantly higher than those exosomes from healthy subjects, and we validated our findings with samples from 16 additional donors. This is the first comparative study of the proteomes of TNBC patient-derived and CD151-deleted exosomes. |