Protein detail
TA2R
Thromboxane A2 receptor (TXA2-R) (Prostanoid TP receptor)
Entry name TA2R | UniProt ID | EVMP confidence score 0.28 |
Supporting publications (n) 1 | Transmembrane count 7 | Protein classification |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Thromboxane A2 receptor (TXA2-R) (Prostanoid TP receptor)
Protein Function (3)
- Disease related genes
- Human disease related genes:Cardiovascular diseases:Hematologic diseases
- G-protein coupled receptors:GPCRs excl olfactory receptors
Transmembrane
30..52; Helical; Name=1; 67..87; Helical; Name=2; 107..128; Helical; Name=3; 150..172; Helical; Name=4; 194..219; Helical; Name=5; 247..270; Helical; Name=6; 290..311; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Supporting publications (n)
1
EVMP confidence score
0.28
Fluorescence & Localization
Tissue SpecificlungCell SpecificAlveolar cells type 1Single-Nuclei Brain Specificcentral nervous system macrophageSecretome LocationSecreted in other tissuesSecretome FunctionReceptor
Function & Pathway
Protein Function (3)
- Disease related genes
- Human disease related genes:Cardiovascular diseases:Hematologic diseases
- G-protein coupled receptors:GPCRs excl olfactory receptors
Cellular Component (3)
Molecular Function (3)
Biological Process (3)
KEGG (3)
Reactome (11)
- R-hsa-373076 class a 1 rhodopsin like receptors
- R-hsa-391903 eicosanoid ligand binding receptors
- R-hsa-500792 gpcr ligand binding
- R-hsa-416482 g alpha 12 13 signalling events
- R-hsa-416476 g alpha q signalling events
- R-hsa-109582 hemostasis
- R-hsa-76002 platelet activation signaling and aggregation
- R-hsa-391908 prostanoid ligand receptors
- R-hsa-372790 signaling by gpcr
- R-hsa-392518 signal amplification
Page 1 of 2
Canonical Pathways (2)
- M65 Pid fra pathway
- M255 Pid hif1 tfpathway
Mediation Categories (3)
Clinical-translation mediationImmune mediationReceptor-signaling mediation
Relations & Evidence97
Enzyme-Mediated Modification (31)
31 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| TBXA2R | PRKACA | P17612 | S | 331 | phosphorylation | SIGNOR_ProtMapperPhosphoSiteSIGNORProtMapper | SIGNOR:12147288ProtMapper:12147288 |
| TBXA2R | PRKACA | P17612 | T | 332 | phosphorylation | MIMPPhosphoSitePhosphoSite_MIMP | |
| TBXA2R | PRKACA | P17612 | S | 330 | phosphorylation | MIMPPhosphoSitePhosphoSite_MIMP | |
| TBXA2R | PRKACA | P17612 | S | 324 | phosphorylation | PhosphoSite | |
| TBXA2R | PRKACA | P17612 | S | 329 | phosphorylation | NCI-PID_ProtMapperProtMapperKEAPhosphoSitePhosphoSite_ProtMapper | ProtMapper:11389883KEA:11749379ProtMapper:7961988ProtMapper:10827090 |
| TBXA2R | PRKG1 | Q13976 | T | 332 | phosphorylation | MIMPPhosphoSitePhosphoSite_MIMP | |
| TBXA2R | PRKG1 | Q13976 | S | 330 | phosphorylation | MIMPPhosphoSitePhosphoSite_MIMP | |
| TBXA2R | PRKG1 | Q13976 | S | 331 | phosphorylation | NCI-PID_ProtMapperPhosphoSiteProtMapper | ProtMapper:17466390ProtMapper:11516166ProtMapper:9560198ProtMapper:14530262ProtMapper:9915793 |
| TBXA2R | PRKG1 | Q13976 | T | 337 | phosphorylation | NCI-PID_ProtMapperProtMapper | ProtMapper:17466390ProtMapper:11516166ProtMapper:9560198ProtMapper:14530262ProtMapper:9915793 |
| TBXA2R | GRK2 | P25098 | S | 357 | phosphorylation | MIMPPhosphoSitePhosphoSite_MIMP |
Page 1 of 4Next
Ligand-Receptor Signaling (57)
57 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | CellPhoneDB | Yes | Yes | |||
| receptor | receptor | HPMR | Yes | Yes | |||
| receptor | receptor | CellChatDB | Yes | Yes | |||
| receptor | receptor | CellTalkDB | Yes | Yes | |||
| receptor | receptor | Surfaceome | Yes | Yes | |||
| receptor | receptor | Ramilowski2015 | Yes | Yes | |||
| gpcr | receptor | DGIdb | Yes | Yes | |||
| receptor | receptor | LRdb | Yes | Yes | |||
| gpcr | receptor | Almen2009 | Yes | Yes | |||
| rhodopsin | receptor | Almen2009 | Yes | Yes |
Page 1 of 6Next
Regulatory Interaction Network (8)
8 records.
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Protein Organic Solvent Precipitation | Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
343
Mass
37,431
Sequence
MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTRSSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPLLLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPGSWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSEVEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWNQILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=Alpha, Placenta receptor; IsoId=P21731-3; Sequence=Displayed; Name=2; Synonyms=Beta, Endothelial receptor; IsoId=P21731-2; Sequence=VSP_001925
Alternative Sequence
329..343; SLSLQPQLTQRSGLQ -> RSLTLWPSLEYSGTISAHCNLRLPGSSDSRASASRAAGITGVSHCARPCMLFDPEFDLLAGVQLLPFEPPTGKALSRKD (in isoform 2)
3D Structural Models
Turn
19..25; 28..32; 137..139; 308..311
Helix
33..55; 63..90; 95..98; 104..135; 146..164; 167..169; 191..226; 229..234; 239..269; 284..298; 300..307; 313..319
Beta Strand
174..176; 183..185
3D Structure
Electron microscopy (2)
Domain & Motif Annotations
Protein Families
G-protein coupled receptor 1 family
Sequence Similarities
Belongs to the G-protein coupled receptor 1 family.
Clinical Relevance
Related Diseases (13)
Biomarker
Phase 2; Discontinued in Phase 3; Terminated; Phase 1; Phase 4; Approved; Clinical trial; Phase 2/3
Drugs (15)
Interaction Protein
ENSG00000123131
Interaction Count
1
Interaction Dataset
intact_biogrid
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 32560723 | T2 and T17 cytokines alter the cargo and function of airway epithelium-derived extracellular vesicles. | No related sentences available |