Protein detail
FGFR2
Fibroblast growth factor receptor 2 (FGFR-2) (EC 2.7.10.1) (K-sam) (KGFR) (Keratinocyte growth factor receptor) (CD antigen CD332)
Entry name FGFR2 | UniProt ID | EVMP confidence score 0.25 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification Cancer-related genesCD markersDisease related genesEnzymesFDA approved drug targetsHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsPredicted secreted proteinsRAS pathway related proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Fibroblast growth factor receptor 2 (FGFR-2) (EC 2.7.10.1) (K-sam) (KGFR) (Keratinocyte growth factor receptor) (CD antigen CD332)
Protein Class (11)
Cancer-related genesCD markersDisease related genesEnzymesFDA approved drug targetsHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsPredicted secreted proteinsRAS pathway related proteins
Protein Function (16)
- Cancer-related genes:Mutational cancer driver genes
- Human disease related genes:Cancers:Cancers of the digestive system
- Predicted intracellular proteins
- Human disease related genes:Congenital malformations:Congenital malformations of the musculoskeletal system
- ENZYME proteins:Transferases
- Cancer-related genes:Mutated cancer genes
- CD markers
- RAS pathway related proteins
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
Page 1 of 2
Transmembrane
378..398; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (10)
BEKCD332CEK3CFD1ECT1JWSK-SAMKGFRTK14TK25
Gene Description
Fibroblast growth factor receptor 2
Chromosome
10
Position
121478332-121598458
Supporting publications (n)
1
EVMP confidence score
0.25
Fluorescence & Localization4
Tissue SpecificbrainCell SpecificBrain excitatory neuronsBlood Cell Specificplasmacytoid DC
Function & Pathway8
Protein Function (16)
- Cancer-related genes:Mutational cancer driver genes
- Human disease related genes:Cancers:Cancers of the digestive system
- Predicted intracellular proteins
- Human disease related genes:Congenital malformations:Congenital malformations of the musculoskeletal system
- ENZYME proteins:Transferases
- Cancer-related genes:Mutated cancer genes
- CD markers
- RAS pathway related proteins
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
Page 1 of 2
Cellular Component (12)
- GO:0005576 extracellular region
- GO:0005634 nucleus
- GO:0005737 cytoplasm
- GO:0005794 Golgi apparatus
- GO:0005886 plasma membrane
- GO:0005938 cell cortex
- GO:0009986 cell surface
- GO:0016020 membrane
- GO:0031410 cytoplasmic vesicle
- GO:0043235 receptor complex
Page 1 of 2
Molecular Function (8)
Biological Process (3)
KEGG (13)
- hsa01521 EGFR tyrosine kinase inhibitor resistance
- KEGG:hsa04010 MAPK signaling pathway
- KEGG:hsa04014 Ras signaling pathway
- KEGG:hsa04015 Rap1 signaling pathway
- KEGG:hsa04020 Calcium signaling pathway
- KEGG:hsa04144 Endocytosis
- KEGG:hsa04151 PI3K-Akt signaling pathway
- KEGG:hsa04550 Signaling pathways regulating pluripotency of stem cells
- KEGG:hsa04810 Regulation of actin cytoskeleton
- KEGG:hsa05200 Pathways in cancer
Page 1 of 2
Reactome (27)
- R-hsa-2219530 constitutive signaling by aberrant pi3k in cancer
- R-hsa-5663202 diseases of signal transduction by growth factor receptors and second messengers
- R-hsa-5654696 downstream signaling of activated fgfr2
- R-hsa-190377 fgfr2b ligand binding and activation
- R-hsa-190375 fgfr2c ligand binding and activation
- R-hsa-6803529 fgfr2 alternative splicing
- R-hsa-190241 fgfr2 ligand binding and activation
- R-hsa-1839126 fgfr2 mutant receptor activation
- R-hsa-5654700 frs mediated fgfr2 signaling
- R-hsa-74751 insulin receptor signalling cascade
Page 1 of 3
Canonical Pathways (3)
- M56 Pid lpa4 pathway
- M8 Pid endothelin pathway
- M15 Pid lysophospholipid pathway
Mediation Categories (4)
Clinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence93
Enzyme-Mediated Modification (5)
5 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| FGFR2 | PRKCE | Q02156 | S | 782 | phosphorylation | SIGNOR_ProtMapperSIGNORProtMapper | SIGNOR:23564461ProtMapper:23564461 |
| FGFR2 | MAPK3 | P27361 | S | 780 | phosphorylation | PhosphoSite | |
| FGFR2 | MAPK1 | P28482 | S | 780 | phosphorylation | PhosphoSite | |
| FGFR2 | FGF2 | P09038 | S | 780 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:18332103 |
| FGFR2 | FGFR1 | P11362 | Y | 769 | phosphorylation | KEA | KEA:17570479 |
Ligand-Receptor Signaling (61)
61 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | Membranome | No | No | Yes | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | CSPA | No | No | Yes | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | HPMR | No | No | Yes | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | No | No | Yes | Yes | No |
| secreted | secreted | UniProt_keyword | No | No | Yes | Yes | No |
| secreted | secreted | HPA_secretome | No | No | Yes | Yes | No |
| secreted | secreted | OmniPath | No | No | Yes | Yes | No |
| cell_surface | cell_surface | Surfaceome | No | No | Yes | Yes | No |
| cell_surface | cell_surface | connectomeDB2020 | No | No | Yes | Yes | No |
| cell_surface | cell_surface | OmniPath | No | No | Yes | Yes | No |
Regulatory Interaction Network (20)
20 records.
Page 1 of 2Next
Protein Complex Composition (6)
6 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| FGF10FGFR2 | O15520P21802 | 1:1 | PDB | PDB:1nun | ||
| FGF1FGFR2 | P05230P21802 | 2:2 | PDB | PDB:4j23PDB:1e0oPDB:3ojmPDB:3cu1PDB:3oj2PDB:1djs | ||
| FGF2FGFR2 | P09038P21802 | 4:4 | PDB | PDB:1ii4PDB:1ev2PDB:1iil | ||
| FGFR2 | P21802 | 2 | PDB | PDB:5ugxPDB:6lvlPDB:8e1xPDB:7ozyPDB:2pzpPDB:8stgPDB:4j96PDB:4j99PDB:2pz5PDB:8w38PDB:2psqPDB:5uhnPDB:7kiePDB:8u1fPDB:6v6qPDB:4wv1PDB:4j97PDB:3euuPDB:4j95PDB:3darPDB:9u3nPDB:8h75PDB:8w3bPDB:3ri1PDB:3b2tPDB:8w3dPDB:6lvkPDB:5uglPDB:8swePDB:2py3PDB:2pvfPDB:8w2xPDB:6agxPDB:7kiaPDB:2pzrPDB:2pvyPDB:2pwlPDB:5ui0PDB:4j98PDB:2q0b | ||
| FGF8FGFR2 | P21802P55075 | 2:2 | PDB | PDB:2fdb | ||
| C8orf74FGFR2MORN2 | P21802Q502X0Q6P047 | 0:0:0 | hu.MAP |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 27863537 |
Sequence, Structure & Domains15
Sequences
Length
821
Mass
92,025
Sequence
MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVLPAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTKRIPLRRQVTVSAESSSSMNSNTPLVRITTRLSSTADTPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT
Alternative Products
Event=Alternative splicing; Named isoforms=17; Name=1; Synonyms=BEK, FGFR2IIIc; IsoId=P21802-1; Sequence=Displayed; Name=2; Synonyms=Short; IsoId=P21802-2; Sequence=VSP_002978; Name=3; Synonyms=BFR-1, FGFR2IIIb, KGFR; IsoId=P21802-3; Sequence=VSP_002969, VSP_002970, VSP_002971, VSP_002972; Name=4; Synonyms=K-sam; IsoId=P21802-4; Sequence=VSP_002964, VSP_002969, VSP_002970, VSP_002971, VSP_002972, VSP_002975, VSP_002976; Name=5; Synonyms=K-sam-I, BEK, IgIIIc; IsoId=P21802-5; Sequence=VSP_002975; Name=6; Synonyms=K-sam-IIC2; IsoId=P21802-6; Sequence=VSP_002975, VSP_002984; Name=7; Synonyms=K-sam-IIC3; IsoId=P21802-8; Sequence=VSP_002975, VSP_002978; Name=8; Synonyms=K-sam-IV, Soluble KGFR; IsoId=P21802-14; Sequence=VSP_002965, VSP_002966; Name=9; Synonyms=K-sam-III; IsoId=P21802-15; Sequence=VSP_002968; Name=10; Synonyms=TK14; IsoId=P21802-16; Sequence=VSP_002967, VSP_002975; Name=11; IsoId=P21802-17; Sequence=VSP_002969, VSP_002970, VSP_002971, VSP_002972, VSP_002978; Name=12; Synonyms=K-sam-IIC1, KGFR, IgIIIb; IsoId=P21802-18; Sequence=VSP_002969, VSP_002970, VSP_002971, VSP_002972, VSP_002975; Name=13; Synonyms=Soluble KGFR; IsoId=P21802-19; Sequence=VSP_002969, VSP_002970, VSP_002971, VSP_002972, VSP_002973, VSP_002974; Name=14; IsoId=P21802-20; Sequence=VSP_019608, VSP_019609; Name=15; IsoId=P21802-21; Sequence=VSP_002964, VSP_041915; Name=16; IsoId=P21802-22; Sequence=VSP_002964, VSP_002969, VSP_002970, VSP_002971, VSP_002972, VSP_002978; Name=17; IsoId=P21802-23; Sequence=VSP_041914
Alternative Sequence
37..152; EPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKR -> G (in isoform 14); 37..125; Missing (in isoform 4, isoform 15 and isoform 16); 250..361; Missing (in isoform 17); 250..254; ERSPH -> GSQGL (in isoform 8); 255..821; Missing (in isoform 8); 313; K -> KVTK (in isoform 10); 314..429; Missing (in isoform 9); 314..330; AAGVNTTDKEIEVLYIR -> HSGINSSNAEVLALF (in isoform 3, isoform 4, isoform 11, isoform 12, isoform 13 and isoform 16); 334..335; FE -> EA (in isoform 3, isoform 4, isoform 11, isoform 12, isoform 13 and isoform 16); 341..353; TCLAGNSIGISFH -> ICKVSNYIGQANQ (in isoform 3, isoform 4, isoform 11, isoform 12, isoform 13 and isoform 16); 361; P -> PKQQ (in isoform 3, isoform 4, isoform 11, isoform 12, isoform 13 and isoform 16); 362..365; APGR -> GRRC (in isoform 13); 366..821; Missing (in isoform 13); 428..429; Missing (in isoform 4, isoform 5, isoform 6, isoform 7, isoform 10 and isoform 12); 429..430; Missing (in isoform 14); 761..821; LTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT -> PPNPSLMSIFRK (in isoform 4); 768..821; EYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT -> I (in isoform 2, isoform 7, isoform 11 and isoform 16); 769..821; YLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT -> EKKVSGAVDCHKPPCNPSHLPCVLAVDQ (in isoform 15); 778..821; QYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT -> PYSPCYPDPR (in isoform 6)
3D Structural Models
Turn
159..162; 463..465; 472..474; 490..492; 585..588; 636..638; 652..654; 659..662
Helix
200..202; 211..213; 223..225; 321..323; 334..336; 478..480; 525..541; 572..577; 590..592; 594..596; 600..619; 629..631; 645..647; 667..669; 672..677; 682..697; 709..718; 730..739; 744..746; 750..764
Beta Strand
152..157; 166..170; 175..178; 181..185; 188..193; 203..205; 208..210; 215..218; 227..235; 238..249; 266..269; 274..277; 287..293; 296..298; 299..301; 303..305; 309..314; 315..319; 324..327; 338..346; 349..360; 481..489; 494..500; 504..506; 513..518; 550..554; 556..558; 561..565; 568..571; 632..634; 640..642; 655..658; 664..666; 726..728
3D Structure
NMR spectroscopy (1); X-ray crystallography (56)
Domain & Motif Annotations
Compositional Bias
131..144; Acidic residues
Domain (CC)
The second and third Ig-like domains directly interact with fibroblast growth factors (FGF) and heparan sulfate proteoglycans. Alternative splicing events affecting the third Ig-like domain are crucial for ligand selectivity.
Domain (FT)
25..125; Ig-like C2-type 1; 154..247; Ig-like C2-type 2; 256..358; Ig-like C2-type 3; 481..770; Protein kinase
Region
131..151; Disordered; 161..178; Heparin-binding
Protein Families (3)
- Protein kinase superfamily
- Tyr protein kinase family
- Fibroblast growth factor receptor subfamily
Sequence Similarities
Belongs to the protein kinase superfamily. Tyr protein kinase family. Fibroblast growth factor receptor subfamily.
Clinical Relevance9
Disease Involvement (8)
Cancer-related genesCraniosynostosisDisease variantEctodermal dysplasiaFDA approved drug targetsIntellectual disabilityLacrimo-auriculo-dento-digital syndromeProto-oncogene
Related Diseases (11)
Biomarker
Phase 1/2; Phase 2; Approved; Phase 3; Terminated; Phase 1
Drug Targets
FDA approved drug targets
Drugs (86)
S-49076INAVOLISIBXL228NINTEDANIB ESYLATEDOVITINIBFEXAGRATINIBNULLOLVEREMBATINIBALPELISIBNAVITOCLAXBRIVANIBDERAZANTINIBPD173074ORANTINIBPALIFERMINBEMARITUZUMABRABEPRAZOLETG100-801PEGINTERFERON ALFA-2AINFIGRATINIBHMPL-453MUPARFOSTATFUTIBATINIBMK-2461FGFR INHIBITOR CPL304110RG-1530SUNITINIBERDAFITINIBCETRELIMABAKT INHIBITOR MK2206TINENGOTINIBZOTATIFINVEMURAFENIBFGFR INHIBITOR DEBIO 1347TASURGRATINIBPONATINIBENMD-2076TRAFERMINPICTILISIBENMD-981693REGORAFENIBKIN-3248BUPARLISIBMASITINIBPAZOPANIBAEE-788ABT-737APRUTUMAB IXADOTINZOLIGRATINIBXL999LY2874455FPA144LUCITANIBTRAMETINIB DIMETHYL SULFOXIDEPEMIGATINIBINFIGRATINIB PHOSPHATEAZD-4547FULVESTRANTVARGATEFFGFR1/2/3 INHIBITOR TYRA-200FP-1039THALIDOMIDEMEK INHIBITOR RO4987655LENVATINIBSELUMETINIBROGARATINIBALOFANIBAPRUTUMABFGFR/CSF-1R INHIBITOR 3D185LY-2874455LIRAFUGRATINIBOXALIPLATINPRN1371ODM-203CP-459632AVUTOMETINIBTRABECTEDINFGF RECEPTOR ANTAGONIST HGS1036TEMUTERKIBCEDIRANIBXL-999GUNAGRATINIBLEUCOVORIN CALCIUMPHA-665752BRIVANIB ALANINATEFLUOROURACIL
Interaction Protein (5)
ENSG00000070193ENSG00000077782ENSG00000113578ENSG00000138685ENSG00000179295
Interaction Count
5
Interaction Dataset
intact_biogrid
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 28986585 | Quantitation of putative colorectal cancer biomarker candidates in serum extracellular vesicles by targeted proteomics. | No abstract available |