Protein detail
CD9
CD9 antigen (5H9 antigen) (Cell growth-inhibiting gene 2 protein) (Leukocyte antigen MIC3) (Motility-related protein) (MRP-1) (Tetraspanin-29) (Tspan-29) (p24) (CD antigen CD9)
Entry name CD9 | UniProt ID | EVMP confidence score 0.88 |
Supporting publications (n) 409 | Transmembrane count 4 | Protein classification Cancer-related genesCD markersPlasma proteinsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
CD9 antigen (5H9 antigen) (Cell growth-inhibiting gene 2 protein) (Leukocyte antigen MIC3) (Motility-related protein) (MRP-1) (Tetraspanin-29) (Tspan-29) (p24) (CD antigen CD9)
Protein Class (5)
Cancer-related genesCD markersPlasma proteinsPredicted membrane proteinsTransporters
Protein Function (3)
- Cancer-related genes:Candidate cancer biomarkers
- CD markers
- Transporters:Accessory Factors Involved in Transport
Transmembrane
13..33; Helical; 56..76; Helical; 88..111; Helical; 196..221; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
BA2MIC3MRP-1P24TSPAN29
Gene Description
CD9 molecule
Chromosome
12
Position
6199715-6238271
Supporting publications (n)
409
EVMP confidence score
0.88
Fluorescence & Localization
Function & Pathway
Protein Function (3)
- Cancer-related genes:Candidate cancer biomarkers
- CD markers
- Transporters:Accessory Factors Involved in Transport
Cellular Component (11)
- GO:0005615 extracellular space
- GO:0005886 plasma membrane
- GO:0005925 focal adhesion
- GO:0009897 external side of plasma membrane
- GO:0016020 membrane
- GO:0030666 endocytic vesicle membrane
- GO:0030669 clathrin-coated endocytic vesicle membrane
- GO:0031092 platelet alpha granule membrane
- GO:0032991 protein-containing complex
- GO:0070062 extracellular exosome
Page 1 of 2
Molecular Function (2)
Biological Process (3)
Reactome (10)
- R-hsa-1300645 acrosome reaction and sperm oocyte membrane binding
- R-hsa-9824439 bacterial infection pathways
- R-hsa-1187000 fertilization
- R-hsa-109582 hemostasis
- R-hsa-5663205 infectious disease
- R-hsa-76002 platelet activation signaling and aggregation
- R-hsa-1474165 reproduction
- R-hsa-76005 response to elevated platelet cytosolic ca2
- R-hsa-5339562 uptake and actions of bacterial toxins
- R-hsa-5336415 uptake and function of diphtheria toxin
Mediation Categories (4)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence41
Ligand-Receptor Signaling (32)
32 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | Yes | ||
| cell_adhesion | cell_adhesion | Zhong2015 | Yes | Yes | Yes | ||
| adhesion | adhesion | OmniPath | Yes | Yes | Yes | ||
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | Yes | ||
| transmembrane | transmembrane | UniProt_location | Yes | ||||
| transmembrane | transmembrane | UniProt_topology | Yes | ||||
| transmembrane | transmembrane | UniProt_keyword | Yes | ||||
| transmembrane | transmembrane | TopDB | Yes | ||||
| transmembrane | transmembrane | LOCATE | Yes | ||||
| transmembrane | transmembrane | Ramilowski_location | Yes |
Protein Complex Composition (8)
8 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| ASAP3CD96CER1HSPA1BLDB3 | O75112O95813P0DMV9P40200Q8TDY4 | 0:0:0:0:0 | hu.MAP2 | |||
| CD96HSPA1ALDB3 | O75112P0DMV8P40200 | 0:0:0 | hu.MAP | |||
| CD96HSPA1BLDB3 | O75112P0DMV9P40200 | 0:0:0 | hu.MAP | |||
| AFG2BCD96HSPA1BLDB3 | O75112P0DMV9P40200Q9BVQ7 | 0:0:0:0 | hu.MAP2 | |||
| CCNB2CD96CRHBPNAA20POGLUT1SQSTM1TNIP1 | O95067P24387P40200P61599Q13501Q15025Q8NBL1 | 0:0:0:0:0:0:0 | hu.MAP2 | |||
| CD99 | P14209 | 2 | PDB | PDB:7sfx | ||
| CD9 | P21926 | 4 | PDB | PDB:6z20PDB:6rlrPDB:6rlo | ||
| CD93 | Q9NPY3 | 4 | PDB | PDB:8ivd |
Sequence, Structure & Domains
Sequences
Length
228
Mass
25,416
Sequence
MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV
3D Structural Models
Turn
154..156; 169..172
Helix
5..37; 41..45; 55..82; 86..111; 114..133; 137..139; 140..150; 161..166; 173..175; 181..190; 193..222
3D Structure
X-ray crystallography (5)
Domain & Motif Annotations
Protein Families
Tetraspanin (TM4SF) family
Sequence Similarities
Belongs to the tetraspanin (TM4SF) family.
Clinical Relevance
Disease Involvement
Cancer-related genes
Drugs (43)
FLUOXETINE HYDROCHLORIDEDOTHIEPINPROPIONIBACTERIUM ACNESNORZOTEPINECITALOPRAMZIPRASIDONEMILNACIPRANVENLAFAXINEIMIPRAMINE HYDROCHLORIDELUMATEPERONEFLUVOXAMINERECOMBINANT EOTAXINTHERAPEUTIC STEROID HORMONEPAROXETINE HYDROCHLORIDE, HEMIHYDRATESIBUTRAMINETYROSINE KINASE INHIBITORLEVOMILNACIPRANATOMOXETINE HYDROCHLORIDEVORTIOXETINE HYDROBROMIDEZOTEPINEPROTRIPTYLINEDULOXETINE HYDROCHLORIDENORTRIPTYLINE[3H]PAROXETINERECOMBINANT INTERLEUKIN-16LIFTHERAPEUTIC ANDROGENDESIPRAMINEAMOXAPINESERTRALINE HYDROCHLORIDEIL-5DESVENLAFAXINE SUCCINATELOFEPRAMINEDOXEPIN HYDROCHLORIDECLOMIPRAMINETOLUDESVENLAFAXINEHERBIMYCIN ANEFAZODONEPHENELZINEVILAZODONE HYDROCHLORIDEDAPOXETINEAMITRIPTYLINE HYDROCHLORIDETRIMIPRAMINE
Antibody
Interaction Protein (2)
ENSG00000110651ENSG00000134247
Interaction Count
2
Interaction Dataset (2)
biogrid_opencellintact_biogrid_opencell
Supporting Publications409
| PMID | Title | Related sentences |
|---|---|---|
| 31749189 | Cancer-associated fibroblasts-derived exosomes-mediated transfer of LINC00355 regulates bladder cancer cell proliferation and invasion. | Exosomes were extracted from CAFs and NFs and observed under a transmission electron microscope, and expression of the exosome markers CD9 and CD63 was confirmed by western blotting. |
| 31766102 | Activation of CD137 signaling promotes neointimal formation by attenuating TET2 and transferrring from endothelial cell-derived exosomes to vascular smooth muscle cells. | ECs transduced with the TET2-overexpression lentivirus showed that the activation of endothelial CD137 signaling decreased TET2 expression and the TET2 content in exosomes. |
| 31786017 | Electrochemical immunosensing of nanovesicles as biomarkers for breast cancer. | To achieve that, the exosomes were preconcentrated from cell-culture supernatant (and eventually in human serum) on magnetic particles modified with antibodies against the general tetraspanins CD9, CD63 and CD81, as well as specific receptors of cancer (CD24, CD44, CD54, CD326 and CD340). |
| 31792471 | [Isolation and biological characteristics of exosomes derived from periodontal ligament stem cells]. | The PDLSC-derived exosomes could express the common surface adhesion molecules CD9, CD63, CD81 and TSG101. |
| 31800531 | Exosomal miR-451 from human umbilical cord mesenchymal stem cells attenuates burn-induced acute lung injury. | The expression of the protein markers CD9 and CD63 in the exosomes was determined by western blot analysis. |
| 31823250 | Transmigration of Tetraspanin 2 (Tspan2) siRNA Via Microglia Derived Exosomes across the Blood Brain Barrier Modifies the Production of Immune Mediators by Microglia Cells. | Furthermore, a decrease in the gene expression levels of the Interleukins, IL-13 and IL-10 and an increase in the gene expression levels for the Fc gamma receptor 2A(FCGR2A) and TNF-α occurred in HTHU-HIV microglial cells These data demonstrate that HTHU exosomes cross the BBB and are efficient delivery vehicles to the CNS. |
| 31858380 | Bone marrow mesenchymal stem cell-secreted exosomes carrying microRNA-125b protect against myocardial ischemia reperfusion injury via targeting SIRT7. | BMSC-derived exosomes were successfully isolated and identified by TEM and positive expression of CD9 and CD63. |
| 31878991 | [Human THP-1 macrophages activated by exosomes derived from lung adenocarcinoma cells promote lung cancer cell invasion]. | Following 24-hour treatment of macrophages with the exosomes (200 μg/mL), the mRNA levels of transforming growth factor β (TGF-β), tumor necrosis factor α (TNF-α), inducible nitric oxide synthase (iNOS) and CD163 were detected by RT-qPCR, and the protein levels of IL-6, IL-8 and IL-10 were measured by IMMULITE 1000. |
| 31885909 | A Method for the Isolation of Exosomes from Human and Bovine Milk. | The key exosomal characteristics of spherical/donut-shaped morphology, the presence of exosomal markers, e.g., FLOT-1 and the tetraspanins, CD9 and CD81), and particle concentration were confirmed in both human and bovine milk exosomes. |
| 31894881 | Chicken seminal fluid lacks CD9- and CD44-bearing extracellular vesicles. | Chicken seminal fluid lacks CD9- and CD44-bearing extracellular vesicles. In the present study, sperm-free SF from Red Jungle Fowl, White Leghorn and an advanced intercross (AIL, 12th generation) were studied using flow cytometry of the membrane marker tetraspanin CD9, Western blotting of the membrane receptor CD44 and electron microscopy in non-enriched (whole SF) or enriched fractions obtained by precipitation using a commercial kit (Total Exosome Precipitation Solution). Its complex proteome might either be free or linked to extracellular vesicles (EVs) as it is the case in mammals, where EVs depict the tetraspanin CD9; and where those EVs derived from the epididymis (epididymosomes) also present the receptor CD44. |