Protein detail
CD9
CD9 antigen (5H9 antigen) (Cell growth-inhibiting gene 2 protein) (Leukocyte antigen MIC3) (Motility-related protein) (MRP-1) (Tetraspanin-29) (Tspan-29) (p24) (CD antigen CD9)
Entry name CD9 | UniProt ID | EVMP confidence score 0.88 |
Supporting publications (n) 409 | Transmembrane count 4 | Protein classification Cancer-related genesCD markersPlasma proteinsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
CD9 antigen (5H9 antigen) (Cell growth-inhibiting gene 2 protein) (Leukocyte antigen MIC3) (Motility-related protein) (MRP-1) (Tetraspanin-29) (Tspan-29) (p24) (CD antigen CD9)
Protein Class (5)
Cancer-related genesCD markersPlasma proteinsPredicted membrane proteinsTransporters
Protein Function (3)
- Cancer-related genes:Candidate cancer biomarkers
- CD markers
- Transporters:Accessory Factors Involved in Transport
Transmembrane
13..33; Helical; 56..76; Helical; 88..111; Helical; 196..221; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
BA2MIC3MRP-1P24TSPAN29
Gene Description
CD9 molecule
Chromosome
12
Position
6199715-6238271
Supporting publications (n)
409
EVMP confidence score
0.88
Fluorescence & Localization
Function & Pathway
Protein Function (3)
- Cancer-related genes:Candidate cancer biomarkers
- CD markers
- Transporters:Accessory Factors Involved in Transport
Cellular Component (11)
- GO:0005615 extracellular space
- GO:0005886 plasma membrane
- GO:0005925 focal adhesion
- GO:0009897 external side of plasma membrane
- GO:0016020 membrane
- GO:0030666 endocytic vesicle membrane
- GO:0030669 clathrin-coated endocytic vesicle membrane
- GO:0031092 platelet alpha granule membrane
- GO:0032991 protein-containing complex
- GO:0070062 extracellular exosome
Page 1 of 2
Molecular Function (2)
Biological Process (3)
Reactome (10)
- R-hsa-1300645 acrosome reaction and sperm oocyte membrane binding
- R-hsa-9824439 bacterial infection pathways
- R-hsa-1187000 fertilization
- R-hsa-109582 hemostasis
- R-hsa-5663205 infectious disease
- R-hsa-76002 platelet activation signaling and aggregation
- R-hsa-1474165 reproduction
- R-hsa-76005 response to elevated platelet cytosolic ca2
- R-hsa-5339562 uptake and actions of bacterial toxins
- R-hsa-5336415 uptake and function of diphtheria toxin
Mediation Categories (4)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence41
Ligand-Receptor Signaling (32)
32 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | Yes | ||
| cell_adhesion | cell_adhesion | Zhong2015 | Yes | Yes | Yes | ||
| adhesion | adhesion | OmniPath | Yes | Yes | Yes | ||
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | Yes | ||
| transmembrane | transmembrane | UniProt_location | Yes | ||||
| transmembrane | transmembrane | UniProt_topology | Yes | ||||
| transmembrane | transmembrane | UniProt_keyword | Yes | ||||
| transmembrane | transmembrane | TopDB | Yes | ||||
| transmembrane | transmembrane | LOCATE | Yes | ||||
| transmembrane | transmembrane | Ramilowski_location | Yes |
Protein Complex Composition (8)
8 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| ASAP3CD96CER1HSPA1BLDB3 | O75112O95813P0DMV9P40200Q8TDY4 | 0:0:0:0:0 | hu.MAP2 | |||
| CD96HSPA1ALDB3 | O75112P0DMV8P40200 | 0:0:0 | hu.MAP | |||
| CD96HSPA1BLDB3 | O75112P0DMV9P40200 | 0:0:0 | hu.MAP | |||
| AFG2BCD96HSPA1BLDB3 | O75112P0DMV9P40200Q9BVQ7 | 0:0:0:0 | hu.MAP2 | |||
| CCNB2CD96CRHBPNAA20POGLUT1SQSTM1TNIP1 | O95067P24387P40200P61599Q13501Q15025Q8NBL1 | 0:0:0:0:0:0:0 | hu.MAP2 | |||
| CD99 | P14209 | 2 | PDB | PDB:7sfx | ||
| CD9 | P21926 | 4 | PDB | PDB:6z20PDB:6rlrPDB:6rlo | ||
| CD93 | Q9NPY3 | 4 | PDB | PDB:8ivd |
Sequence, Structure & Domains
Sequences
Length
228
Mass
25,416
Sequence
MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV
3D Structural Models
Turn
154..156; 169..172
Helix
5..37; 41..45; 55..82; 86..111; 114..133; 137..139; 140..150; 161..166; 173..175; 181..190; 193..222
3D Structure
X-ray crystallography (5)
Domain & Motif Annotations
Protein Families
Tetraspanin (TM4SF) family
Sequence Similarities
Belongs to the tetraspanin (TM4SF) family.
Clinical Relevance
Disease Involvement
Cancer-related genes
Drugs (43)
FLUOXETINE HYDROCHLORIDEDOTHIEPINPROPIONIBACTERIUM ACNESNORZOTEPINECITALOPRAMZIPRASIDONEMILNACIPRANVENLAFAXINEIMIPRAMINE HYDROCHLORIDELUMATEPERONEFLUVOXAMINERECOMBINANT EOTAXINTHERAPEUTIC STEROID HORMONEPAROXETINE HYDROCHLORIDE, HEMIHYDRATESIBUTRAMINETYROSINE KINASE INHIBITORLEVOMILNACIPRANATOMOXETINE HYDROCHLORIDEVORTIOXETINE HYDROBROMIDEZOTEPINEPROTRIPTYLINEDULOXETINE HYDROCHLORIDENORTRIPTYLINE[3H]PAROXETINERECOMBINANT INTERLEUKIN-16LIFTHERAPEUTIC ANDROGENDESIPRAMINEAMOXAPINESERTRALINE HYDROCHLORIDEIL-5DESVENLAFAXINE SUCCINATELOFEPRAMINEDOXEPIN HYDROCHLORIDECLOMIPRAMINETOLUDESVENLAFAXINEHERBIMYCIN ANEFAZODONEPHENELZINEVILAZODONE HYDROCHLORIDEDAPOXETINEAMITRIPTYLINE HYDROCHLORIDETRIMIPRAMINE
Antibody
Interaction Protein (2)
ENSG00000110651ENSG00000134247
Interaction Count
2
Interaction Dataset (2)
biogrid_opencellintact_biogrid_opencell
Supporting Publications409
| PMID | Title | Related sentences |
|---|---|---|
| 32544615 | The role of extracellular vesicles in COVID-19 virus infection. | Extracellular vesicles may contribute to spread this virus as they transfer such receptors as CD9 and ACE2, which make recipient cells susceptible to virus docking. |
| 32589377 | Comparative analysis of exosome markers and extracellular vesicles between colorectal cancer and cancer-associated normal colonic mucosa. | Tetraspanins (CD9, CD63) belong to the well\xe2\x80\x91known exosome markers, but can also be found on other subtypes of extracellular vesicles (EVs). |
| 32600030 | Simultaneous Detection of a Cluster of Differentiation Markers on Leukemia-Derived Exosomes by Multiplex Immuno-Polymerase Chain Reaction via Capillary Electrophoresis Analysis. | With the method, we first realized simultaneous detection of five target CD molecules (CD9, CD34, c-Kit/CD117, CD123, and FLT-3/CD135) on leukemia cell-derived exosomes with high detection sensitivity. |
| 32713614 | Circulating exosomes with lung self-antigens as a biomarker for chronic lung allograft dysfunction: A retrospective analysis. | Circulating exosomes from BOS and stable LTxRs demonstrated 61- to 181-nm vesicles with markers Alix and CD9. |
| 32730952 | Surface functionalization of exosomes for target-specific delivery and in vivo imaging & tracking: Strategies and significance. | The specific exosomal membrane proteins such as tetraspanins (CD63, CD81, CD9), lactadherin (LA), lysosome associated membrane protein-2b (Lamp-2b) and, glycosyl-phosphatidyl-inositol (GPI) involved in functionalization of exosome surface have also been discussed along with different strategies of surface modification like genetic engineering, covalent modification (click chemistry and metabolic engineering of parent cells of exosomes) and non-covalent modification (multivalent electrostatic interactions, ligand-receptor interaction, hydrophobic interaction, aptamer based modification and modification by anchoring CP05 peptide) along with optical (fluorescent and bioluminescent) and radioactive isotope labelling techniques of exosomes for imaging purpose. |
| 32747437 | Cytotrophoblast extracellular vesicles enhance decidual cell secretion of immune modulators via TNFα. | No related sentences available |
| 32767662 | Exosomal lncRNA H19 promotes the progression of hepatocellular carcinoma treated with Propofol via miR-520a-3p/LIMK1 axis. | Quantitative real-time polymerase chain reaction (qRT-PCR) and Western blot were performed to detect the expression of long noncoding RNA (lncRNA) H19, microRNA-520a-3p (miR-520a-3p), LIM domain kinase 1 (LIMK1), metastasis-associated markers (Snail, Twist, Vimentin and E-cadherin) and exosome markers (CD9 and CD81). |
| 32793278 | Plasma Small Extracellular Vesicles Derived miR-21-5p and miR-92a-3p as Potential Biomarkers for Hepatocellular Carcinoma Screening. | The exosomes were isolated by precipitation with a reagent based on polyethylene glycol and were characterized based on morphological aspects (i.e., diameter); molecular weight; CD63, CD9, and CD81 protein markers; and exosomal miR-21-5p and miR-92a-3p expression levels. |
| 32795414 | Extracellular Vesicle and Particle Biomarkers Define Multiple Human Cancers. | Among traditional exosome markers, CD9, HSPA8, ALIX, and HSP90AB1 represent pan-EVP markers, while ACTB, MSN, and RAP1B are novel pan-EVP markers. |
| 32801874 | A Polyethylene Glycol-Based Method for Enrichment of Extracellular Vesicles from Culture Supernatant of Human Ovarian Cancer Cell Line A2780 and Body Fluids of High-Grade Serous Carcinoma Patients. | This study tried to evaluate whether 8% polyethylene glycol (PEG) 6000 precipitation combined with differential ultracentrifugation (PPDU) was an efficient and practical method for the enrichment and purification of extracellular vesicles (EVs) derived from the culture supernatant of human ovarian cancer cell line A2780 and from body fluids of patients with high-grade serous carcinoma (HGSC). |