Protein detail

CD9

CD9 antigen (5H9 antigen) (Cell growth-inhibiting gene 2 protein) (Leukocyte antigen MIC3) (Motility-related protein) (MRP-1) (Tetraspanin-29) (Tspan-29) (p24) (CD antigen CD9)

Entry name
CD9
UniProt ID
EVMP confidence score
0.88
Supporting publications (n)
409
Transmembrane count
4
Protein classification
Cancer-related genesCD markersPlasma proteinsPredicted membrane proteinsTransporters
Basic Information
Protein Names
CD9 antigen (5H9 antigen) (Cell growth-inhibiting gene 2 protein) (Leukocyte antigen MIC3) (Motility-related protein) (MRP-1) (Tetraspanin-29) (Tspan-29) (p24) (CD antigen CD9)
Protein Class (5)
Cancer-related genesCD markersPlasma proteinsPredicted membrane proteinsTransporters
Protein Function (3)
  • Cancer-related genes:Candidate cancer biomarkers
  • CD markers
  • Transporters:Accessory Factors Involved in Transport
Transmembrane
13..33; Helical; 56..76; Helical; 88..111; Helical; 196..221; Helical
Transmembrane Count
4
Entrez Gene Symbol
Gene Synonym (5)
BA2MIC3MRP-1P24TSPAN29
Gene Description
CD9 molecule
Chromosome
12
Position
6199715-6238271
Supporting publications (n)
409
EVMP confidence score
0.88
Fluorescence & Localization
CD9 fluorescence
Function & Pathway
Relations & Evidence41

Ligand-Receptor Signaling (32)

32 records.

CategoryParentDatabaseTransmitterReceiverSecretedPlasma Membrane (Transmembrane)Plasma Membrane (Peripheral)
cell_adhesioncell_adhesionCellinkerYesYesYes
cell_adhesioncell_adhesionZhong2015YesYesYes
adhesionadhesionOmniPathYesYesYes
cell_adhesioncell_adhesionOmniPathYesYesYes
transmembranetransmembraneUniProt_locationYes
transmembranetransmembraneUniProt_topologyYes
transmembranetransmembraneUniProt_keywordYes
transmembranetransmembraneTopDBYes
transmembranetransmembraneLOCATEYes
transmembranetransmembraneRamilowski_locationYes
Page 2 of 4PreviousNext

Protein Complex Composition (8)

8 records.

Component NameComponent Gene SymbolsComponent UniProt IDStoichiometryDatabaseDatabase IDsReferences
ASAP3CD96CER1HSPA1BLDB3O75112O95813P0DMV9P40200Q8TDY40:0:0:0:0hu.MAP2
CD96HSPA1ALDB3O75112P0DMV8P402000:0:0hu.MAP
CD96HSPA1BLDB3O75112P0DMV9P402000:0:0hu.MAP
AFG2BCD96HSPA1BLDB3O75112P0DMV9P40200Q9BVQ70:0:0:0hu.MAP2
CCNB2CD96CRHBPNAA20POGLUT1SQSTM1TNIP1O95067P24387P40200P61599Q13501Q15025Q8NBL10:0:0:0:0:0:0hu.MAP2
CD99P142092PDBPDB:7sfx
CD9P219264PDBPDB:6z20PDB:6rlrPDB:6rlo
CD93Q9NPY34PDBPDB:8ivd

Isolation & Detection Technology (1)

1 record.

EV Isolation MethodDetection MethodNumber of ReferencesReferences
Differential UltracentrifugationSize Exclusion ChromatographyMass spectrometryWestern blotting23766754736849061
Sequence, Structure & Domains

Sequences

Length
228
Mass
25,416
Sequence
MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV

3D Structural Models

Turn
154..156; 169..172
Helix
5..37; 41..45; 55..82; 86..111; 114..133; 137..139; 140..150; 161..166; 173..175; 181..190; 193..222
3D Structure
X-ray crystallography (5)

Domain & Motif Annotations

Protein Families
Tetraspanin (TM4SF) family
Sequence Similarities
Belongs to the tetraspanin (TM4SF) family.
Clinical Relevance
Supporting Publications409
PMIDTitleRelated sentences
33649776Exosome-mediated radiosensitizing effect on neighboring cancer cells via increase in intracellular levels of reactive oxygen species.In order to confirm the presence of exosomes in the human pancreatic cancer cell line MIAPaCa\xe2\x80\x912, ultracentrifugation was performed followed by transmission electron microscopy and nanoparticle tracking analysis\xc2\xa0(NanoSight) using the exosome\xe2\x80\x91specific surface markers CD9 and CD63.
33669497Resistance Training Diminishes the Expression of Exosome CD63 Protein without Modification of Plasma miR-146a-5p and cfDNA in the Elderly.Resistance Training Diminishes the Expression of Exosome CD63 Protein without Modification of Plasma miR-146a-5p and cfDNA in the Elderly. The levels of exosome markers (Flot-1, CD9, and CD81) as well as exosome-carried proteins (CD14 and VDAC1) remained unchanged, whereas an attenuated CD63 response was found in the trained group compared to the controls. The levels of plasma miR-146a-5p, cfDNA, and exosome markers (CD9, CD14, CD63, CD81, Flotillin [Flot]-1, and VDAC1) were measured prior to and following training. These findings might partially support the anti-inflammatory effect of resistance training in the elderly as evidenced by the diminishment of exosome CD63 protein expression, without modification of plasma miR-146a-5p and cfDNA.
33717398Chimeric antigen-guiding extracellular vesicles eliminate antigen-specific Th2 cells in subjects with food allergy.Purified mEVs had the molecular markers of extracellular vesicle, CD81, CD63, and CD9, cleaved Casp3 and MHC II/OVA complexes. This study aims to eliminate the Ag-specific Th2 cells with a novel nanoparticle, the mEV (modified extracellular vesicles, that carry a chimeric antigen peptide, MHC II and caspase 3) in a murine FA model.
33724661ALIX and ceramide differentially control polarized small extracellular vesicle release from epithelial cells.Here, we established methods of studying exosomal heterogeneity by using polarized epithelial cells and showed that distinct types of small extracellular vesicles (more specifically CD9- and CD63-positive, Annexin I-negative small extracellular vesicles, which we refer to as exosomes herein) are differentially secreted from the apical and basolateral sides of polarized epithelial cells. Thus, two independent machineries, the ALIX-Syntenin1-Syndecan1 machinery (apical side) and the sphingomyelinase-dependent ceramide production machinery (basolateral side), are likely to be responsible for the polarized exosome release from epithelial cells. We also identify GPRC5C (G protein-coupled receptor class C group 5 member C) as an apical exosome-specific protein.
33725248Effect of Intranasal Administration of Multipotent Mesenchymal Stromal Cell Exosomes on Memory of Mice in Alzheimer's Disease Model.Intranasal administration of isolated exosomes expressing typical markers CD9, CD63 and CD81 improved spatial memory in bulbectomized animals, which manifested in a significant increase in the number of visits to the target sector and the time spent there in comparison with indifferent sectors.
33766230[Exosomes derived from human placental mesenchymal stem cells reduce human lung microvascular endothelial cell injury induced by lipopolysaccharide via enhancing autophagy].The morphological characteristics of exosomes were observed by transmission electron microscopy, and the expression of specific markers CD9 and CD63 on the surface of exosomes was detected by Western blotting.
33773551Exosomal Protease Cargo as Prognostic Biomarker in Colorectal Cancer.Protease cargo in CD9-positive blood plasma exosomes is prognostic biomarker for colorectal polyps and colorectal cancer. The levels of 20S proteasomes and ADAM10+/ADAM17- subpopulations in CD9-positive blood plasma exosomes are the most significant values for predicting relapse-free survival. The levels of 20S proteasomes in exosomes, MMP9+, MMP9+/MMP2+/EMMPRIN+ in CD9-positive blood plasma exosomes are associated with the risk of malignant transformation of colorectal tubulovillous adenomas. The subpopulations of CD151- and Tspan8-positive exosomes, the subpopulations of metalloproteinase at the surface of \xd0\xa1D9-positive exosomes and the level of 20S proteasomes in plasma exosomes in 15 CPPs (tubulovillous adenomas) and 60 CRCPs were evaluated using flow cytometry and Western blotting.
33808296CD5L as an Extracellular Vesicle-Derived Biomarker for Liquid Biopsy of Lung Cancer.No related sentences available
33834667[microRNA-1 gene delivery mediated by exosomes suppresses CAL-27 cell proliferation].The well-known exosome markers CD9, Tsg101, and Alix were enriched.
33925027Isolation of Small Extracellular Vesicles from Human Sera.DUC samples contained higher concentrations of exosome specific proteins CD9, CD63 and CD81 and electron microscopy confirmed that most particles in DUC preparations were sEV, whereas Exo-spin\xe2\x84\xa2 samples also contained copious co-purified plasma lipids.
Page 25 of 41PreviousNext