Protein detail

CD9

CD9 antigen (5H9 antigen) (Cell growth-inhibiting gene 2 protein) (Leukocyte antigen MIC3) (Motility-related protein) (MRP-1) (Tetraspanin-29) (Tspan-29) (p24) (CD antigen CD9)

Entry name CD9	UniProt ID P21926	EVMP confidence score 0.88
Supporting publications (n) 424	Transmembrane count 4	Protein classification Cancer-related genesCD markersPlasma proteinsPredicted membrane proteinsTransporters

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

CD9 antigen (5H9 antigen) (Cell growth-inhibiting gene 2 protein) (Leukocyte antigen MIC3) (Motility-related protein) (MRP-1) (Tetraspanin-29) (Tspan-29) (p24) (CD antigen CD9)

Protein Class (5)

Cancer-related genesCD markersPlasma proteinsPredicted membrane proteinsTransporters

Protein Function (3)

Cancer-related genes:Candidate cancer biomarkers
CD markers
Transporters:Accessory Factors Involved in Transport

Transmembrane

13..33; Helical; 56..76; Helical; 88..111; Helical; 196..221; Helical

Transmembrane Count

Ensembl

ENSG00000010278

Entrez Gene Symbol

CD9

Gene Synonym (5)

BA2MIC3MRP-1P24TSPAN29

Gene Description

CD9 molecule

Chromosome

Position

6199715-6238271

Supporting publications (n)

424

EVMP confidence score

0.88

Fluorescence & Localization1

Function & Pathway7

Protein Function (3)

Cancer-related genes:Candidate cancer biomarkers
CD markers
Transporters:Accessory Factors Involved in Transport

Cellular Component (11)

Page 1 of 2

Molecular Function (2)

Biological Process (3)

KEGG (2)

Reactome (10)

Mediation Categories (4)

Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediation

Relations & Evidence41

Ligand-Receptor Signaling (32)

32 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
cell_adhesion	cell_adhesion	Cellinker	Yes	Yes	Yes	No	No
cell_adhesion	cell_adhesion	Zhong2015	Yes	Yes	Yes	No	No
adhesion	adhesion	OmniPath	Yes	Yes	Yes	No	No
cell_adhesion	cell_adhesion	OmniPath	Yes	Yes	Yes	No	No
transmembrane	transmembrane	UniProt_location	No	No	Yes	No	No
transmembrane	transmembrane	UniProt_topology	No	No	Yes	No	No
transmembrane	transmembrane	UniProt_keyword	No	No	Yes	No	No
transmembrane	transmembrane	TopDB	No	No	Yes	No	No
transmembrane	transmembrane	LOCATE	No	No	Yes	No	No
transmembrane	transmembrane	Ramilowski_location	No	No	Yes	No	No

Page 2 of 4Previous Next

Protein Complex Composition (8)

8 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
ASAP3 CD96 CER1 HSPA1B LDB3	O75112 O95813 P0DMV9 P40200 Q8TDY4	0:0:0:0:0	hu.MAP2
CD96 HSPA1A LDB3	O75112 P0DMV8 P40200	0:0:0	hu.MAP
CD96 HSPA1B LDB3	O75112 P0DMV9 P40200	0:0:0	hu.MAP
AFG2B CD96 HSPA1B LDB3	O75112 P0DMV9 P40200 Q9BVQ7	0:0:0:0	hu.MAP2
CCNB2 CD96 CRHBP NAA20 POGLUT1 SQSTM1 TNIP1	O95067 P24387 P40200 P61599 Q13501 Q15025 Q8NBL1	0:0:0:0:0:0:0	hu.MAP2
CD99	P14209	2	PDB	PDB:7sfx
CD9	P21926	4	PDB	PDB:6z20PDB:6rlrPDB:6rlo
CD93	Q9NPY3	4	PDB	PDB:8ivd

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometryWestern blotting	2	37667547 36849061

Sequence, Structure & Domains8

Sequences

Length

228

Mass

25,416

Sequence

MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV

3D Structural Models

Turn

154..156; 169..172

Helix

5..37; 41..45; 55..82; 86..111; 114..133; 137..139; 140..150; 161..166; 173..175; 181..190; 193..222

3D Structure

X-ray crystallography (5)

Domain & Motif Annotations

Protein Families

Tetraspanin (TM4SF) family

Sequence Similarities

Belongs to the tetraspanin (TM4SF) family.

Clinical Relevance6

Disease Involvement

Cancer-related genes

Drugs (43)

Antibody

CAB002490

Interaction Protein (2)

ENSG00000110651ENSG00000134247

Interaction Count

Interaction Dataset (2)

biogrid_opencellintact_biogrid_opencell

Supporting Publications409

PMID	Title	Abstract
35143105	Cross-decoration of dendritic cells by non-inherited maternal antigen-containing extracellular vesicles: Potential mechanism for PD-L1-based tolerance in cord blood and organ transplantation.	In adult mice, the production of extracellular vesicles (EVs) from maternal microchimeric cells causes cross-decoration (XD) of offspring dendritic cells (DC) with NIMA and upregulation of PD-L1, contributing to NIMA tolerance.
35175564	Isolation and Identification of Adipose Stem Cell Exosomes and the Study of Its Potential as Drug Delivery Carrier In Vitro.	The data indicated that mASC exosomes separated by our improved sequential filtration method have particle size distribution in 30-150 nm, positively expresses TSG101, CD63, CD9, GADPH, and negatively expresses calnexin.
35182062	Effects of Exosomes Derived from Kidney Tubular Cells on Diabetic Nephropathy in Rats.	The exosomes were assessed in terms of morphology and size, and particular biomarkers were evaluated by transmission electron microscopy (TEM), scanning electron microscopy (SEM), Western blot, atomic force microscopy (AFM) and Zetasizer Nano analysis.
35228162	Exosomal circ_0048856 derived from non-small cell lung cancer contributes to aggressive cancer progression through downregulation of miR-1287-5p.	Exosomes protein markers, CD63 and CD9, were examined by Western blot.
35259607	Kinetics and interaction studies of anti-tetraspanin antibodies and ICAM-1 with extracellular vesicle subpopulations using continuous flow quartz crystal microbalance biosensor.	Continuous flow quartz crystal microbalance (QCM) was utilized to study binding kinetics between EV subpopulations (exomere- and exosome-sized EVs) and four affinity ligands: monoclonal antibodies against tetraspanins (anti-CD9, anti-CD63, and anti-CD81) and recombinant intercellular adhesion molecule-1 (ICAM-1) or CD54 protein).
35260179	A novel protein encoded by circHNRNPU promotes multiple myeloma progression by regulating the bone marrow microenvironment and alternative splicing.	Exosomes were isolated from the culture supernatant of MM cells by ultracentrifugation and characterized by Transmission Electron Microscope and WB confirmation of exosomes markers Alix and CD9.
35274316	Exosomes derived from stem cells from the apical papilla alleviate inflammation in rat pulpitis by upregulating regulatory T cells.	To evaluate the effects of exosomes derived from stem cells from the apical papilla (SCAP-Exos) in rats with experimentally induced pulpitis and the effects of SCAP-Exos on the conversion of regulatory T cells (Tregs) and methylation status of the Foxp3 locus in Tregs in vitro.
35301156	Affinity-based isolation of extracellular vesicles by means of single-domain antibodies bound to macroporous methacrylate-based copolymer.	The combined analyses of morphological features and biomarker (CD9, CD63 and CD81) presence indicated that the recovered EVs were exosomes.
35330909	Reduced Plasma Extracellular Vesicle CD5L Content in Patients With Acute-On-Chronic Liver Failure: Interplay With Specialized Pro-Resolving Lipid Mediators.	Our objective was to analyze macrophage anti-inflammatory protein CD5L in plasma extracellular vesicles (EVs) and assess its as yet unknown relationship with lipid mediators in ACLF.
35345318	Mesenchymal stem cell derived exosomes-based immunological signature in a rat model of corneal allograft rejection therapy.	The nanovesicles obtained were expressing exosome specific protein markers CD9, CD63, CD81.

Page 31 of 41Previous Next