Protein detail

CD9

CD9 antigen (5H9 antigen) (Cell growth-inhibiting gene 2 protein) (Leukocyte antigen MIC3) (Motility-related protein) (MRP-1) (Tetraspanin-29) (Tspan-29) (p24) (CD antigen CD9)

Entry name
CD9
UniProt ID
EVMP confidence score
0.88
Supporting publications (n)
424
Transmembrane count
4
Protein classification
Cancer-related genesCD markersPlasma proteinsPredicted membrane proteinsTransporters
EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information13
Protein Names
CD9 antigen (5H9 antigen) (Cell growth-inhibiting gene 2 protein) (Leukocyte antigen MIC3) (Motility-related protein) (MRP-1) (Tetraspanin-29) (Tspan-29) (p24) (CD antigen CD9)
Protein Class (5)
Cancer-related genesCD markersPlasma proteinsPredicted membrane proteinsTransporters
Protein Function (3)
  • Cancer-related genes:Candidate cancer biomarkers
  • CD markers
  • Transporters:Accessory Factors Involved in Transport
Transmembrane
13..33; Helical; 56..76; Helical; 88..111; Helical; 196..221; Helical
Transmembrane Count
4
Entrez Gene Symbol
Gene Synonym (5)
BA2MIC3MRP-1P24TSPAN29
Gene Description
CD9 molecule
Chromosome
12
Position
6199715-6238271
Supporting publications (n)
424
EVMP confidence score
0.88
Fluorescence & Localization1
CD9 fluorescence
Function & Pathway7
Protein Function (3)
  • Cancer-related genes:Candidate cancer biomarkers
  • CD markers
  • Transporters:Accessory Factors Involved in Transport
Mediation Categories (4)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence41

Ligand-Receptor Signaling (32)

32 records.

CategoryParentDatabaseTransmitterReceiverSecretedPlasma Membrane (Transmembrane)Plasma Membrane (Peripheral)
transmembranetransmembraneOmniPathNoNoYesNoNo
plasma_membraneplasma_membraneUniProt_locationNoNoYesNoNo
plasma_membraneplasma_membraneCellinkerNoNoYesNoNo
plasma_membraneplasma_membraneOmniPathNoNoYesNoNo
secretedsecretedUniProt_keywordNoNoYesNoNo
secretedsecretedUniProt_locationNoNoYesNoNo
secretedsecretedOmniPathNoNoYesNoNo
cell_surfacecell_surfaceSurfaceomeNoNoYesNoNo
cell_surfacecell_surfaceconnectomeDB2020NoNoYesNoNo
cell_surfacecell_surfaceBaccin2019NoNoYesNoNo
Page 3 of 4PreviousNext

Isolation & Detection Technology (1)

1 record.

EV Isolation MethodDetection MethodNumber of ReferencesReferences
Differential UltracentrifugationSize Exclusion ChromatographyMass spectrometryWestern blotting23766754736849061
Sequence, Structure & Domains8

Sequences

Length
228
Mass
25,416
Sequence
MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV

3D Structural Models

Turn
154..156; 169..172
Helix
5..37; 41..45; 55..82; 86..111; 114..133; 137..139; 140..150; 161..166; 173..175; 181..190; 193..222
3D Structure
X-ray crystallography (5)

Domain & Motif Annotations

Protein Families
Tetraspanin (TM4SF) family
Sequence Similarities
Belongs to the tetraspanin (TM4SF) family.
Clinical Relevance6
Supporting Publications409
PMIDTitleAbstract
35930994Fibroblast-derived exosomal miRNA-133 promotes cardiomyocyte-like differentiation.The exosomes secreted by CFs were observed as small vesicles of 30-100 nm via transmission electron microscopy, and Western blotting was used to detect exosome-specific protein CD63 and CD9 expression. The expression levels of cTnT, α-actin, and exosome miRNA-133 in the miRNA-133 inhibition group were the lowest. The expression levels of cardiac troponin T (cTnT) and cardiac actin (α-actin) were determined, and qRT-PCR was used to detect the expression of miRNA-133 in the fibroblast exosomes.
35939349Exosomes Derived from microRNA-21 Overexpressing Neural Progenitor Cells Prevent Hearing Loss from Ischemia-Reperfusion Injury in Mice via Inhibiting the Inflammatory Process in the Cochlea.Isolated exosomes were confirmed by the size of 96 ± 25 nm, single membrane, and positive expression of CD9 and Tsg101.
35950642Bone marrow mesenchymal stem cell-derived exosome miR-29b-3p alleviates UV irradiation-induced photoaging in skin fibroblast.Extracted exosomes were positive for HSP70 and CD9.
35957917MiR-520a-5p/PPP5C regulation pattern is identified as the key to gemcitabine resistance in pancreatic cancer.Five groups of HUVEC cells treated with exosomes were subjected to APSC-1 cells had an IC50 value of 227.1 μM for gemcitabine, elevated PPP5C expression, drug resistance, and enhanced HUVEC cell activity; exosomes CD9, CD63, and CD81 were significantly expressed in all groups; meanwhile, enhanced PPP5C expression not only promoted PPP5C has a prognostic role in pancreatic cancer by promoting the value-added and invasion of pancreatic cancer cells, and a targeted inhibitory relationship between miR-520-5p and PPP5C was found.
35963322Proteome profiling of Extracellular Vesicles in Pseudomonas aeruginosa endophthalmitis: Prognostic and therapeutic significance in a mouse model.The result of this study provides insight into the global extracellular vesicle proteome of P. aeruginosa endophthalmitis with their functional correlation and distinctive pattern of expression and tenascin, caveolin 1 and caveolin 2 are attractive biomarkers for P. aeruginosa endophthalmitis.
36060136Bioactivity of Exosomes Derived from Trained Natural Killer Cells versus Non-Trained One: More Functional and Antitumor Activity.Based on flow cytometry, CD56 marker was 89.7% and 40.1% for NK cells and NK-derived exosomes, respectively. CD63 and CD9 were positive for exosomes by western blotting. Furthermore, the trained exosomes showed up-regulation in both P53 and caspase3 genes as compared with non-trained sample.
36063301Stem Cell Exosomes Improve Survival of Neural Stem Cells after Radiation Exposure.All exosomes carried markers CD9, CD63, and TSG101.
36077715Comprehensive Analysis of Serum Small Extracellular Vesicles-Derived Coding and Non-Coding RNAs from Retinoblastoma Patients for Identifying Regulatory Interactions.The results revealed that the isolated sEVs are round-shaped with a size < 150 nm, 5.3 × 1011 ± 8.1 particles/mL, and zeta potential of 11.1 to −15.8 mV, and expressed exosome markers CD9, CD81, and TSG101.
36093484Nonalcoholic Fatty Liver Hepatocyte-Derived lncRNA MALAT1 Aggravates Pancreatic Cell Inflammation via the Inhibition of Autophagy by Upregulating YAP.The MALAT1 was upregulated in NAFLD-derived exosomes and increased the levels of IL-6 and TNF- NAFLD-derived MALAT1 exacerbates pancreatic cell inflammation via inhibiting autophagy by upregulating YAP.
36108271Wharton jelly-derived mesenchymal stem cell exosomes induce apoptosis and suppress EMT signaling in cervical cancer cells as an effective drug carrier system of paclitaxel.In addition, exosomes CD9, CD63, and CD81 markers were checked by western blot.
Page 33 of 41PreviousNext