Protein detail

CD9

CD9 antigen (5H9 antigen) (Cell growth-inhibiting gene 2 protein) (Leukocyte antigen MIC3) (Motility-related protein) (MRP-1) (Tetraspanin-29) (Tspan-29) (p24) (CD antigen CD9)

Entry name CD9	UniProt ID P21926	EVMP confidence score 0.88
Supporting publications (n) 424	Transmembrane count 4	Protein classification Cancer-related genesCD markersPlasma proteinsPredicted membrane proteinsTransporters

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

CD9 antigen (5H9 antigen) (Cell growth-inhibiting gene 2 protein) (Leukocyte antigen MIC3) (Motility-related protein) (MRP-1) (Tetraspanin-29) (Tspan-29) (p24) (CD antigen CD9)

Protein Class (5)

Cancer-related genesCD markersPlasma proteinsPredicted membrane proteinsTransporters

Protein Function (3)

Cancer-related genes:Candidate cancer biomarkers
CD markers
Transporters:Accessory Factors Involved in Transport

Transmembrane

13..33; Helical; 56..76; Helical; 88..111; Helical; 196..221; Helical

Transmembrane Count

Ensembl

ENSG00000010278

Entrez Gene Symbol

CD9

Gene Synonym (5)

BA2MIC3MRP-1P24TSPAN29

Gene Description

CD9 molecule

Chromosome

Position

6199715-6238271

Supporting publications (n)

424

EVMP confidence score

0.88

Fluorescence & Localization1

Function & Pathway7

Protein Function (3)

Cancer-related genes:Candidate cancer biomarkers
CD markers
Transporters:Accessory Factors Involved in Transport

Cellular Component (11)

Page 1 of 2

Molecular Function (2)

Biological Process (3)

KEGG (2)

Reactome (10)

Mediation Categories (4)

Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediation

Relations & Evidence41

Ligand-Receptor Signaling (32)

32 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
transmembrane	transmembrane	OmniPath	No	No	Yes	No	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	Yes	No	No
plasma_membrane	plasma_membrane	Cellinker	No	No	Yes	No	No
plasma_membrane	plasma_membrane	OmniPath	No	No	Yes	No	No
secreted	secreted	UniProt_keyword	No	No	Yes	No	No
secreted	secreted	UniProt_location	No	No	Yes	No	No
secreted	secreted	OmniPath	No	No	Yes	No	No
cell_surface	cell_surface	Surfaceome	No	No	Yes	No	No
cell_surface	cell_surface	connectomeDB2020	No	No	Yes	No	No
cell_surface	cell_surface	Baccin2019	No	No	Yes	No	No

Page 3 of 4Previous Next

Protein Complex Composition (8)

8 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
ASAP3 CD96 CER1 HSPA1B LDB3	O75112 O95813 P0DMV9 P40200 Q8TDY4	0:0:0:0:0	hu.MAP2
CD96 HSPA1A LDB3	O75112 P0DMV8 P40200	0:0:0	hu.MAP
CD96 HSPA1B LDB3	O75112 P0DMV9 P40200	0:0:0	hu.MAP
AFG2B CD96 HSPA1B LDB3	O75112 P0DMV9 P40200 Q9BVQ7	0:0:0:0	hu.MAP2
CCNB2 CD96 CRHBP NAA20 POGLUT1 SQSTM1 TNIP1	O95067 P24387 P40200 P61599 Q13501 Q15025 Q8NBL1	0:0:0:0:0:0:0	hu.MAP2
CD99	P14209	2	PDB	PDB:7sfx
CD9	P21926	4	PDB	PDB:6z20PDB:6rlrPDB:6rlo
CD93	Q9NPY3	4	PDB	PDB:8ivd

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometryWestern blotting	2	37667547 36849061

Sequence, Structure & Domains8

Sequences

Length

228

Mass

25,416

Sequence

MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV

3D Structural Models

Turn

154..156; 169..172

Helix

5..37; 41..45; 55..82; 86..111; 114..133; 137..139; 140..150; 161..166; 173..175; 181..190; 193..222

3D Structure

X-ray crystallography (5)

Domain & Motif Annotations

Protein Families

Tetraspanin (TM4SF) family

Sequence Similarities

Belongs to the tetraspanin (TM4SF) family.

Clinical Relevance6

Disease Involvement

Cancer-related genes

Drugs (43)

Antibody

CAB002490

Interaction Protein (2)

ENSG00000110651ENSG00000134247

Interaction Count

Interaction Dataset (2)

biogrid_opencellintact_biogrid_opencell

Supporting Publications409

PMID	Title	Abstract
36119932	VEGFA-Enriched Exosomes from Tendon-Derived Stem Cells Facilitate Tenocyte Differentiation, Migration, and Transition to a Fibroblastic Phenotype.	Successful isolation of exosomes from TDSCs was confirmed by high expression levels of CD81, CD63, CD9, and TSG101.
36130685	Advanced 3D dynamic culture system with transforming growth factor-β3 enhances production of potent extracellular vesicles with modified protein cargoes via upregulation of TGF-β signaling.	No abstract available
36175423	Exosome biopotentiated hydrogel restores damaged skeletal muscle in a porcine model of stress urinary incontinence.	The present work utilizes a human platelet-derived CD41a and CD9 expressing extracellular vesicle product (PEP) enriched for NF-κB and PD-L1 and derived to ensure the preservation of lipid bilayer for enhanced stability and compatibility with hydrogel-based sustained delivery approaches.
36190183	Exosomes derived from endothelial progenitor cells ameliorate glyoxylate deprivation (OGD)-induced neuronal apoptosis by delivering miR-221-3p.	Mouse EPCs were cultured in vitro, and exosomes were isolated and identified using transmission electron microscopy (TEM), particle size analysis and by determining the protein expressions of exosome markers (CD9, CD63 and Alix). Western blot assay showed that CD9, CD63 and Alix were enriched in exosomes.
36203458	CD9- and CD81-positive extracellular vesicles provide a marker to monitor glioblastoma cell response to photon-based and proton-based radiotherapy.	No abstract available
36203609	Circulating CD81-expressing extracellular vesicles as biomarkers of response for immune-checkpoint inhibitors in advanced NSCLC.	No abstract available
36225174	Macrophage-Derived Exosomes in TLR9-/- Mice Ameliorate Sepsis-Induced Mitochondrial Oxidative Stress and Apoptosis in Cardiomyocytes.	The The expressions of p-PI3K, p-AKT, exosome markers (CD9, CD63, and TSG101), p-ERK1/2, TNF- TLR9 Copyright © 2022 Xiang Li et al.
36240643	Exosomes derived from human umbilical cord mesenchymal stem cells (HUCMSC-EXO) regulate autophagy through AMPK-ULK1 signaling pathway to ameliorate diabetic cardiomyopathy.	Immunoblotting was used to determine the expression of CD9, CD63, and TSG101 molecules on the surface of the exosomes.
36312392	Sequential Method for Analysis of CTCs and Exosomes from the Same Sample of Patient Blood.	The exosome analysis resulted in the identification of ∼500-1000 exosome proteins per sample confirmed by detection of exosome surface markers CD9, CD63, CD81, and TSG101 in addition to proteins related to cancer progression.
36324609	Monitoring of Post-Brain Injuries By Measuring Plasma Levels of Neuron-Derived Extracellular Vesicles.	A sandwich immunoassay was established to measure plasma NDE using anti-neuron CD171 and anti-EV CD9 ([CD171 The specificity, linearity, and reproducibility of NDE assay (measurement of [CD171 The blood test to determine plasma levels of NDE was established by a sandwich immunoassay using 2 antibodies against neuron (CD171) and exosomes (CD9).

Page 34 of 41Previous Next