Protein detail

CD9

CD9 antigen (5H9 antigen) (Cell growth-inhibiting gene 2 protein) (Leukocyte antigen MIC3) (Motility-related protein) (MRP-1) (Tetraspanin-29) (Tspan-29) (p24) (CD antigen CD9)

Entry name
CD9
UniProt ID
EVMP confidence score
0.88
Supporting publications (n)
424
Transmembrane count
4
Protein classification
Cancer-related genesCD markersPlasma proteinsPredicted membrane proteinsTransporters
EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information13
Protein Names
CD9 antigen (5H9 antigen) (Cell growth-inhibiting gene 2 protein) (Leukocyte antigen MIC3) (Motility-related protein) (MRP-1) (Tetraspanin-29) (Tspan-29) (p24) (CD antigen CD9)
Protein Class (5)
Cancer-related genesCD markersPlasma proteinsPredicted membrane proteinsTransporters
Protein Function (3)
  • Cancer-related genes:Candidate cancer biomarkers
  • CD markers
  • Transporters:Accessory Factors Involved in Transport
Transmembrane
13..33; Helical; 56..76; Helical; 88..111; Helical; 196..221; Helical
Transmembrane Count
4
Entrez Gene Symbol
Gene Synonym (5)
BA2MIC3MRP-1P24TSPAN29
Gene Description
CD9 molecule
Chromosome
12
Position
6199715-6238271
Supporting publications (n)
424
EVMP confidence score
0.88
Fluorescence & Localization1
CD9 fluorescence
Function & Pathway7
Protein Function (3)
  • Cancer-related genes:Candidate cancer biomarkers
  • CD markers
  • Transporters:Accessory Factors Involved in Transport
Mediation Categories (4)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence41

Ligand-Receptor Signaling (32)

32 records.

CategoryParentDatabaseTransmitterReceiverSecretedPlasma Membrane (Transmembrane)Plasma Membrane (Peripheral)
cell_surfacecell_surfaceOmniPathNoNoYesNoNo
transmembranetransmembrane_predictedPhobiusNoNoYesNoNo
Page 4 of 4Previous

Isolation & Detection Technology (1)

1 record.

EV Isolation MethodDetection MethodNumber of ReferencesReferences
Differential UltracentrifugationSize Exclusion ChromatographyMass spectrometryWestern blotting23766754736849061
Sequence, Structure & Domains8

Sequences

Length
228
Mass
25,416
Sequence
MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV

3D Structural Models

Turn
154..156; 169..172
Helix
5..37; 41..45; 55..82; 86..111; 114..133; 137..139; 140..150; 161..166; 173..175; 181..190; 193..222
3D Structure
X-ray crystallography (5)

Domain & Motif Annotations

Protein Families
Tetraspanin (TM4SF) family
Sequence Similarities
Belongs to the tetraspanin (TM4SF) family.
Clinical Relevance6
Supporting Publications409
PMIDTitleAbstract
30021922Development of a Highly Sensitive Device for Counting the Number of Disease-Specific Exosomes in Human Sera.Furthermore, analyses of a cross-sectional cohort of sera samples revealed that HER2-positive exosomes were significantly increased in patients with breast cancer or ovarian cancer compared with healthy individuals and those with noncancer diseases. In addition to the ubiquitous exosome markers CD9 and CD63, the cancer-related antigens CD147, carcinoembryonic antigen, and human epidermal growth factor receptor 2 (HER2) were also used to quantify cancer cell line-derived exosomes.
30032860Comparative proteomics of respiratory exosomes in cystic fibrosis, primary ciliary dyskinesia and asthma.Exosome enrichment was validated by electron microscopy and immunodetection of CD9, CD63 and ALIX. PCD and CF exosomes contained higher levels of antioxidant proteins (Superoxide-dismutase, Glutathione peroxidase-3, Peroxiredoxin-5) and proteins involved in leukocyte chemotaxis.
30043563Biological characteristics of osteoclast exosomes and their role in the osteogenic differentiation of somatic cells prior to osteogenesis.Ultra-filtration centrifugation was used to separate OC-exosomes from osteoclast supernatant, while Western blot was employed to detect the expression characteristics of exosomal proteins CD9 and CD63.
30098419Prostate cancer sheds the αvβ3 integrin in vivo through exosomes.Furthermore, using PSMA antibody-bead mediated immunocapture, we show that the αvβ3 integrin is expressed in a subset of exosomes characterized by PSMA, CD9, CD63, and an epithelial-specific marker, Trop-2.
30126376Malignant canine mammary epithelial cells shed exosomes containing differentially expressed microRNA that regulate oncogenic networks.CMEC and CMT cell lines shed round, "cup-shaped" exosomes approximately 150-200 nm, and were immunopositive for exosomal marker CD9.
30187874[Adenoid cystic carcinoma cells produce exosomes that promote tumor cell proliferation].The exosomes isolated from SACC-83 cells showed a size range of 30-100 nm and expressed the exosomal markers CD9, CD63 and TSG101.
30191215Microfluidic affinity separation chip for selective capture and release of label-free ovarian cancer exosomes.We present a herringbone-grooved microfluidic device which is covalently functionalized with antibodies against general and cancer exosome membrane biomarkers (CD9 and EpCAM) to isolate exosomes from small volumes of high-grade serous ovarian cancer (HGSOC) serum.
30198786Photo-Oxidative Blue-Light Stimulation in Retinal Pigment Epithelium Cells Promotes Exosome Secretion and Increases the Activity of the NLRP3 Inflammasome.After blue-light photostimulation, ARPE-19 cells were noted to release exosomes with higher levels of IL-1β, IL-18, and caspase-1 than those in the control group. The contents of the NLRP3 inflammasome (IL-1β, IL-18, and caspase-1 as markers of the inflammasome) in exosomes were analyzed by Western blotting. The exosome markers CD9, CD63, and CD81 were strongly present. The levels of IL-1β, IL-18, and caspase-1 in ARPE-19 cells were significantly enhanced when treated with stressed RPE exosomes.
30248150Pre-eclampsia is associated with altered expression of the renal sodium transporters NKCC2, NCC and ENaC in urinary extracellular vesicles.Expression, proteolytic cleavage and phosphorylation was determined by densitometric analysis normalized to the exosome marker CD9.
30251702Palmitoylation is a post-translational modification of Alix regulating the membrane organization of exosome-like small extracellular vesicles.The multifunctional protein Alix is a bona fide exosomal regulator and skeletal muscle cells can release Alix-positive nano-sized extracellular vesicles, offering a new paradigm for understanding how myofibers communicate within skeletal muscle and with other organs. We propose that S-palmitoylation regulates the function of Alix in facilitating the interactions among extracellular vesicle-specific regulators and maintains the proper structural organization of exosome-like extracellular vesicle membranes.
Page 13 of 41PreviousNext