Protein detail

CD9

CD9 antigen (5H9 antigen) (Cell growth-inhibiting gene 2 protein) (Leukocyte antigen MIC3) (Motility-related protein) (MRP-1) (Tetraspanin-29) (Tspan-29) (p24) (CD antigen CD9)

Entry name CD9	UniProt ID P21926	EVMP confidence score 0.88
Supporting publications (n) 424	Transmembrane count 4	Protein classification Cancer-related genesCD markersPlasma proteinsPredicted membrane proteinsTransporters

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

CD9 antigen (5H9 antigen) (Cell growth-inhibiting gene 2 protein) (Leukocyte antigen MIC3) (Motility-related protein) (MRP-1) (Tetraspanin-29) (Tspan-29) (p24) (CD antigen CD9)

Protein Class (5)

Cancer-related genesCD markersPlasma proteinsPredicted membrane proteinsTransporters

Protein Function (3)

Cancer-related genes:Candidate cancer biomarkers
CD markers
Transporters:Accessory Factors Involved in Transport

Transmembrane

13..33; Helical; 56..76; Helical; 88..111; Helical; 196..221; Helical

Transmembrane Count

Ensembl

ENSG00000010278

Entrez Gene Symbol

CD9

Gene Synonym (5)

BA2MIC3MRP-1P24TSPAN29

Gene Description

CD9 molecule

Chromosome

Position

6199715-6238271

Supporting publications (n)

424

EVMP confidence score

0.88

Fluorescence & Localization1

Function & Pathway7

Protein Function (3)

Cancer-related genes:Candidate cancer biomarkers
CD markers
Transporters:Accessory Factors Involved in Transport

Cellular Component (11)

Page 1 of 2

Molecular Function (2)

Biological Process (3)

KEGG (2)

Reactome (10)

Mediation Categories (4)

Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediation

Relations & Evidence41

Ligand-Receptor Signaling (32)

32 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
cell_surface	cell_surface	OmniPath	No	No	Yes	No	No
transmembrane	transmembrane_predicted	Phobius	No	No	Yes	No	No

Page 4 of 4Previous

Protein Complex Composition (8)

8 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
ASAP3 CD96 CER1 HSPA1B LDB3	O75112 O95813 P0DMV9 P40200 Q8TDY4	0:0:0:0:0	hu.MAP2
CD96 HSPA1A LDB3	O75112 P0DMV8 P40200	0:0:0	hu.MAP
CD96 HSPA1B LDB3	O75112 P0DMV9 P40200	0:0:0	hu.MAP
AFG2B CD96 HSPA1B LDB3	O75112 P0DMV9 P40200 Q9BVQ7	0:0:0:0	hu.MAP2
CCNB2 CD96 CRHBP NAA20 POGLUT1 SQSTM1 TNIP1	O95067 P24387 P40200 P61599 Q13501 Q15025 Q8NBL1	0:0:0:0:0:0:0	hu.MAP2
CD99	P14209	2	PDB	PDB:7sfx
CD9	P21926	4	PDB	PDB:6z20PDB:6rlrPDB:6rlo
CD93	Q9NPY3	4	PDB	PDB:8ivd

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometryWestern blotting	2	37667547 36849061

Sequence, Structure & Domains8

Sequences

Length

228

Mass

25,416

Sequence

MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV

3D Structural Models

Turn

154..156; 169..172

Helix

5..37; 41..45; 55..82; 86..111; 114..133; 137..139; 140..150; 161..166; 173..175; 181..190; 193..222

3D Structure

X-ray crystallography (5)

Domain & Motif Annotations

Protein Families

Tetraspanin (TM4SF) family

Sequence Similarities

Belongs to the tetraspanin (TM4SF) family.

Clinical Relevance6

Disease Involvement

Cancer-related genes

Drugs (43)

Antibody

CAB002490

Interaction Protein (2)

ENSG00000110651ENSG00000134247

Interaction Count

Interaction Dataset (2)

biogrid_opencellintact_biogrid_opencell

Supporting Publications409

PMID	Title	Abstract
31407387	Hypoxia alters the release and size distribution of extracellular vesicles in pancreatic cancer cells to support their adaptive survival.	However, CD9 and CD63 (exosome markers) were expressed in both SEV and MEVs with a decreased expression recorded under hypoxia.
31410448	miR-19a-3p containing exosomes improve function of ischaemic myocardium upon shock wave therapy.	Characterization of EVs via electron microscopy, nanoparticle tracking analysis and flow cytometry revealed specific exosome morphology and size with presence of exosome markers CD 9, CD81 and CD63. Exosomes exhibited angiogenic properties activating protein kinase b (Akt) and extracellular-signal regulated kinase (ERK) resulting in enhanced endothelial tube formation and proliferation.
31473497	Exosomes in specific fractions of the boar ejaculate contain CD44: A marker for epididymosomes?	Noteworthy, these pig SP-exosomes were CD44-bearing when analysed by FC, with bands detected by western blotting (WB) at the expected 85 kD size. The findings pave for the selective isolation of exosomes in functional studies of their function when interacting with spermatozoa, the oocyte and/or the female genitalia, including hyaluronan-CD44 interplay.
31594209	High serum extracellular vesicle miR-10b expression predicts poor prognosis in patients with acute myeloid leukemia.	The extracellular vesicles we extracted from the serum samples were positive for EV/exosome markers including TSG101, CD63, Flotillin-1 and CD9.
31611757	Senescent HUVECs-secreted exosomes trigger endothelial barrier dysfunction in young endothelial cells.	Exosomes were isolated from the condition media of senescent human umbilical vein endothelial cells (HUVECs) and then confirmed by the detection of exosome specific CD63 and CD9 expressions, electron microscopy and acetylcholinesterase assay. Exposure to exosomes repressed the expression of adherens junction proteins including vascular endothelial (VE)-cadherin and beta-catenin, decreased cell growth kinetics and impaired endothelial migration potential of young endothelial cells.
31638563	[Exosomes derived from LPS-stimulated macrophages promote TGF-β1-induced epithelial-mesenchymal transition of human type II alveolar epithelial A549 cells].	In comparison with the exosomes derived from untreated naive THP-1 macrophages, exosomes derived from LPS-primed THP-1 cells exhibited an ability to significantly promote TGF-β-induced EMT of A549 cells, as determined by a significantly down-regulated E-cadherin, and an dramatically increased expression of proteins in EMT-related signaling including vimentin, alpha smooth muscle actin (α-SMA), TGF-β1/Smad2/3 signaling proteins Smad2/3 protein and phosphorylated Smad2/3 (p-Smad2/3) and type 1 collagen (Col1). Methods The morphology of exosomes derived from THP-1 macrophages was evaluated by transmission electron microscopy, and the biochemistry properties of exosomes were identified by accessing exosome-specific markers including tumor susceptibility gene 101 (TSG101), accessory protein ALG-2 interacting protein X (ALIX), CD81 and CD9 protein, and the calnexin, a negative control marker absent in exosomes, using an immunoblotting assay.
31641193	Tumour-Secreted Hsp90α on External Surface of Exosomes Mediates Tumour - Stromal Cell Communication via Autocrine and Paracrine Mechanisms.	Anti-Hsp90α antibody nullified the pro-motility activity of tumour-secreted exosomes and human recombinant Hsp90α protein fully rescued the functional defects of eHsp90α-free exosomes. CRISPR-cas9 knockout of Hsp90α did not affect the overall distribution and quantity of secreted exosomes, but it caused increased exosome-associated CD9 and decreased exosome-associated TSG101, Alix, and CD63. Finally, while current exosome biogenesis models exclusively implicate the luminal location of host cytosolic proteins inside secreted exosomes, we provide evidence for eHsp90α location on the external surface of tumour-secreted exosomes. Here we show that eHsp90α accounts for approximately 1% of the total cellular Hsp90α and is associated with tumour-secreted exosomes. However, Hsp90α-knockout tumour cells have not only lost their own constitutive motility, but also the ability to recruit stromal cells via secreted exosomes. Taken together, this study elucidates a new mechanism of action by exosome-associated eHsp90α. These defects are specifically due to the lack of eHsp90α on tumour cell-secreted exosomes.
31648466	[Impact of CD137-CD137L signaling on secretion of mouse vascular smooth muscle cells-derived exosomes: role of Rab7 pathway].	No abstract available
31675489	Environmental pollutant induced cellular injury is reflected in exosomes from placental explants.	Regardless of treatment, placental expressed exosomes markers (PLAP, CD9, CD63, 81 and ALIX), had a size distribution between 50 and 175 nm and were present in the conditioned medium at 5-8 x 10 Environmental exposure of placental explants did not change the quantity of exosomes or their characteristics.
31712601	Extracellular Vesicle-derived circular RNAs confers chemoresistance in Colorectal cancer.	Our exosomes were translucent cup-shaped structures under TEM with differential expression of TSG101, CD9, and CD63.

Page 17 of 41Previous Next