Protein detail

CD9

CD9 antigen (5H9 antigen) (Cell growth-inhibiting gene 2 protein) (Leukocyte antigen MIC3) (Motility-related protein) (MRP-1) (Tetraspanin-29) (Tspan-29) (p24) (CD antigen CD9)

Entry name
CD9
UniProt ID
EVMP confidence score
0.88
Supporting publications (n)
409
Transmembrane count
4
Protein classification
Cancer-related genesCD markersPlasma proteinsPredicted membrane proteinsTransporters
Basic Information
Protein Names
CD9 antigen (5H9 antigen) (Cell growth-inhibiting gene 2 protein) (Leukocyte antigen MIC3) (Motility-related protein) (MRP-1) (Tetraspanin-29) (Tspan-29) (p24) (CD antigen CD9)
Protein Class (5)
Cancer-related genesCD markersPlasma proteinsPredicted membrane proteinsTransporters
Protein Function (3)
  • Cancer-related genes:Candidate cancer biomarkers
  • CD markers
  • Transporters:Accessory Factors Involved in Transport
Transmembrane
13..33; Helical; 56..76; Helical; 88..111; Helical; 196..221; Helical
Transmembrane Count
4
Entrez Gene Symbol
Gene Synonym (5)
BA2MIC3MRP-1P24TSPAN29
Gene Description
CD9 molecule
Chromosome
12
Position
6199715-6238271
Supporting publications (n)
409
EVMP confidence score
0.88
Fluorescence & Localization
CD9 fluorescence
Function & Pathway
Relations & Evidence41

Ligand-Receptor Signaling (32)

32 records.

CategoryParentDatabaseTransmitterReceiverSecretedPlasma Membrane (Transmembrane)Plasma Membrane (Peripheral)
cell_surfacecell_surfaceOmniPathYes
transmembranetransmembrane_predictedPhobiusYes
Page 4 of 4Previous

Protein Complex Composition (8)

8 records.

Component NameComponent Gene SymbolsComponent UniProt IDStoichiometryDatabaseDatabase IDsReferences
ASAP3CD96CER1HSPA1BLDB3O75112O95813P0DMV9P40200Q8TDY40:0:0:0:0hu.MAP2
CD96HSPA1ALDB3O75112P0DMV8P402000:0:0hu.MAP
CD96HSPA1BLDB3O75112P0DMV9P402000:0:0hu.MAP
AFG2BCD96HSPA1BLDB3O75112P0DMV9P40200Q9BVQ70:0:0:0hu.MAP2
CCNB2CD96CRHBPNAA20POGLUT1SQSTM1TNIP1O95067P24387P40200P61599Q13501Q15025Q8NBL10:0:0:0:0:0:0hu.MAP2
CD99P142092PDBPDB:7sfx
CD9P219264PDBPDB:6z20PDB:6rlrPDB:6rlo
CD93Q9NPY34PDBPDB:8ivd

Isolation & Detection Technology (1)

1 record.

EV Isolation MethodDetection MethodNumber of ReferencesReferences
Differential UltracentrifugationSize Exclusion ChromatographyMass spectrometryWestern blotting23766754736849061
Sequence, Structure & Domains

Sequences

Length
228
Mass
25,416
Sequence
MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV

3D Structural Models

Turn
154..156; 169..172
Helix
5..37; 41..45; 55..82; 86..111; 114..133; 137..139; 140..150; 161..166; 173..175; 181..190; 193..222
3D Structure
X-ray crystallography (5)

Domain & Motif Annotations

Protein Families
Tetraspanin (TM4SF) family
Sequence Similarities
Belongs to the tetraspanin (TM4SF) family.
Clinical Relevance
Supporting Publications409
PMIDTitleRelated sentences
20124223Hypoxic tumor cell modulates its microenvironment to enhance angiogenic and metastatic potential by secretion of proteins and exosomes.Ultracentrifugation at 100,000 x g precipitated 54% of the secreted proteins and enriched for many exosome-associated proteins such as the tetraspanins and Alix and also proteins with the potential to facilitate angiogenesis and metastasis.
20138817Exosome secreted by MSC reduces myocardial ischemia/reperfusion injury.They contained coimmunoprecipitating exosome-associated proteins, e.g., CD81, CD9, and Alix.
20880880Proinflammatory exosomes in bronchoalveolar lavage fluid of patients with sarcoidosis.Exosomes from patients showed significantly higher expression of MHC class I and II, tetraspanins CD9, CD63 and CD81 as well as neuregulin-1, known to be associated with cancer progression.
21172122RNA-containing exosomes in human nasal secretions.Flow cytometry of exosomes using anti-major histocompatibility complex class II beads revealed exosomes positive for the tetraspanins CD9, CD63, and CD81. RESULTS: Exosomes were visualized as 40-80 nm, CD63(+) vesicles using EM. Western blot confirmed the presence of exosomal protein and absence of proteins from the endoplasmic reticulum (ER), because the exosomes were positive for Tsg101, but negative for the ER marker, calnexin.
21235781Human saliva, plasma and breast milk exosomes contain RNA: uptake by macrophages.Breast milk exosomes were further analysed for the presence of Hsc70, CD81 and calnexin by Western blot. Flow cytometry was performed by capturing the exosomes on anti-MHC class II coated beads, and further stain with anti-CD9, anti-CD63 or anti-CD81.
21651777Body fluid derived exosomes as a novel template for clinical diagnostics.RESULTS: Exosomes were positive for the marker proteins CD24, CD9, Annexin-1 and Hsp70 and displayed the correct buoyant density and orientation of antigens.
22133690Identification of distinct populations of prostasomes that differentially express prostate stem cell antigen, annexin A1, and GLIPR2 in humans.Both types of vesicle resembled exosomes in terms of their buoyant density, size, and the presence of the ubiquitous exosome marker CD9.
22285593Comparison of ultracentrifugation, density gradient separation, and immunoaffinity capture methods for isolating human colon cancer cell line LIM1863-derived exosomes.Notably, all isolations contained 40-100nm vesicles, and were positive for exosome markers (Alix, TSG101, HSP70) based on electron microscopy and Western blotting. Using the colorectal cancer cell line LIM1863 as a cell model, in this study we performed a comprehensive evaluation of current methods used for exosome isolation including ultracentrifugation (UC-Exos), OptiPrep™ density-based separation (DG-Exos), and immunoaffinity capture using anti-EpCAM coated magnetic beads (IAC-Exos).
22895844Exosomes secreted from human colorectal cancer cell lines contain mRNAs, microRNAs and natural antisense RNAs, that can transfer into the human hepatoma HepG2 and lung cancer A549 cell lines.CD81 was detected in exosomes secreted from the three CRC cell lines. Furthermore, PKH67-labeled exosomes derived from the CRC cell lines were taken up into HepG2 and A549 cells. In the present study, we investigated the tetraspanin family proteins CD63, CD9 and CD81 as useful collection markers of exosomes derived from the three colorectal cancer (CRC) cell lines HCT-15, SW480 and WiDr. This result indicates that CD81 can be a collection marker of exosomes derived from the three CRC cell lines. When the RNA species within exosomes derived from the three CRC cell lines were examined, the mRNAs of housekeeping genes such as ACTB and GAPDH, the microRNAs such as miR-21, miR-192 and miR-221, and the natural antisense RNAs of LRRC24, MDM2 and CDKN1A genes, were detected.
23289620Tetraspanin protein CD9 interacts with metalloprotease CD10 and enhances its release via exosomes.Tetraspanin protein CD9 interacts with metalloprotease CD10 and enhances its release via exosomes. The peptidase activity of CD10 measured either on cells or on exosomes correlated with the level of CD10 expression, and was not significantly modulated by CD9 expression as such. The stable expression of wild-type CD9 in K562 CD10-positive cells enhanced the level of CD10 released with exosomes five-fold.
Page 2 of 41PreviousNext