Protein detail
CD9
CD9 antigen (5H9 antigen) (Cell growth-inhibiting gene 2 protein) (Leukocyte antigen MIC3) (Motility-related protein) (MRP-1) (Tetraspanin-29) (Tspan-29) (p24) (CD antigen CD9)
Entry name CD9 | UniProt ID | EVMP confidence score 0.88 |
Supporting publications (n) 424 | Transmembrane count 4 | Protein classification Cancer-related genesCD markersPlasma proteinsPredicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
CD9 antigen (5H9 antigen) (Cell growth-inhibiting gene 2 protein) (Leukocyte antigen MIC3) (Motility-related protein) (MRP-1) (Tetraspanin-29) (Tspan-29) (p24) (CD antigen CD9)
Protein Class (5)
Cancer-related genesCD markersPlasma proteinsPredicted membrane proteinsTransporters
Protein Function (3)
- Cancer-related genes:Candidate cancer biomarkers
- CD markers
- Transporters:Accessory Factors Involved in Transport
Transmembrane
13..33; Helical; 56..76; Helical; 88..111; Helical; 196..221; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
BA2MIC3MRP-1P24TSPAN29
Gene Description
CD9 molecule
Chromosome
12
Position
6199715-6238271
Supporting publications (n)
424
EVMP confidence score
0.88
Fluorescence & Localization1
Function & Pathway7
Protein Function (3)
- Cancer-related genes:Candidate cancer biomarkers
- CD markers
- Transporters:Accessory Factors Involved in Transport
Cellular Component (11)
- GO:0005615 extracellular space
- GO:0005886 plasma membrane
- GO:0005925 focal adhesion
- GO:0009897 external side of plasma membrane
- GO:0016020 membrane
- GO:0030666 endocytic vesicle membrane
- GO:0030669 clathrin-coated endocytic vesicle membrane
- GO:0031092 platelet alpha granule membrane
- GO:0032991 protein-containing complex
- GO:0070062 extracellular exosome
Page 1 of 2
Molecular Function (2)
Biological Process (3)
Reactome (10)
- R-hsa-1300645 acrosome reaction and sperm oocyte membrane binding
- R-hsa-9824439 bacterial infection pathways
- R-hsa-1187000 fertilization
- R-hsa-109582 hemostasis
- R-hsa-5663205 infectious disease
- R-hsa-76002 platelet activation signaling and aggregation
- R-hsa-1474165 reproduction
- R-hsa-76005 response to elevated platelet cytosolic ca2
- R-hsa-5339562 uptake and actions of bacterial toxins
- R-hsa-5336415 uptake and function of diphtheria toxin
Mediation Categories (4)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence41
Ligand-Receptor Signaling (32)
32 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| cell_surface | cell_surface | OmniPath | No | No | Yes | No | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | Yes | No | No |
Page 4 of 4Previous
Protein Complex Composition (8)
8 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| ASAP3CD96CER1HSPA1BLDB3 | O75112O95813P0DMV9P40200Q8TDY4 | 0:0:0:0:0 | hu.MAP2 | |||
| CD96HSPA1ALDB3 | O75112P0DMV8P40200 | 0:0:0 | hu.MAP | |||
| CD96HSPA1BLDB3 | O75112P0DMV9P40200 | 0:0:0 | hu.MAP | |||
| AFG2BCD96HSPA1BLDB3 | O75112P0DMV9P40200Q9BVQ7 | 0:0:0:0 | hu.MAP2 | |||
| CCNB2CD96CRHBPNAA20POGLUT1SQSTM1TNIP1 | O95067P24387P40200P61599Q13501Q15025Q8NBL1 | 0:0:0:0:0:0:0 | hu.MAP2 | |||
| CD99 | P14209 | 2 | PDB | PDB:7sfx | ||
| CD9 | P21926 | 4 | PDB | PDB:6z20PDB:6rlrPDB:6rlo | ||
| CD93 | Q9NPY3 | 4 | PDB | PDB:8ivd |
Sequence, Structure & Domains8
Sequences
Length
228
Mass
25,416
Sequence
MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV
3D Structural Models
Turn
154..156; 169..172
Helix
5..37; 41..45; 55..82; 86..111; 114..133; 137..139; 140..150; 161..166; 173..175; 181..190; 193..222
3D Structure
X-ray crystallography (5)
Domain & Motif Annotations
Protein Families
Tetraspanin (TM4SF) family
Sequence Similarities
Belongs to the tetraspanin (TM4SF) family.
Clinical Relevance6
Disease Involvement
Cancer-related genes
Drugs (43)
FLUOXETINE HYDROCHLORIDEDOTHIEPINPROPIONIBACTERIUM ACNESNORZOTEPINECITALOPRAMZIPRASIDONEMILNACIPRANVENLAFAXINEIMIPRAMINE HYDROCHLORIDELUMATEPERONEFLUVOXAMINERECOMBINANT EOTAXINTHERAPEUTIC STEROID HORMONEPAROXETINE HYDROCHLORIDE, HEMIHYDRATESIBUTRAMINETYROSINE KINASE INHIBITORLEVOMILNACIPRANATOMOXETINE HYDROCHLORIDEVORTIOXETINE HYDROBROMIDEZOTEPINEPROTRIPTYLINEDULOXETINE HYDROCHLORIDENORTRIPTYLINE[3H]PAROXETINERECOMBINANT INTERLEUKIN-16LIFTHERAPEUTIC ANDROGENDESIPRAMINEAMOXAPINESERTRALINE HYDROCHLORIDEIL-5DESVENLAFAXINE SUCCINATELOFEPRAMINEDOXEPIN HYDROCHLORIDECLOMIPRAMINETOLUDESVENLAFAXINEHERBIMYCIN ANEFAZODONEPHENELZINEVILAZODONE HYDROCHLORIDEDAPOXETINEAMITRIPTYLINE HYDROCHLORIDETRIMIPRAMINE
Antibody
Interaction Protein (2)
ENSG00000110651ENSG00000134247
Interaction Count
2
Interaction Dataset (2)
biogrid_opencellintact_biogrid_opencell
Supporting Publications409
| PMID | Title | Abstract |
|---|---|---|
| 34745768 | Universal extracellular vesicles and PD-L1+ extracellular vesicles detected by single molecule array technology as circulating biomarkers for diffuse large B cell lymphoma. | Using the Single Molecule array (SiMoa) technology, we developed two extracellular vesicle detection assays, CD9-CD63 and PD-L1-CD63, to determine circulating universal EVs and PD-L1 positive EVs, respectively. |
| 34800917 | A method of separating extracellular vesicles from blood shows potential clinical translation, and reveals extracellular vesicle cargo gremlin-1 as a diagnostic biomarker. | No abstract available |
| 34847362 | Detecting early-stage malignant melanoma using a calcium switch-enriched exosome subpopulation containing tumor markers as a sample. | An exosome species containing CD63 as a marker of melanoma was isolated from bulk exosome population and used as a sample for detecting malignant melanoma. |
| 34900726 | A Multivariate Diagnostic Model Based on Urinary EpCAM-CD9-Positive Extracellular Vesicles for Prostate Cancer Diagnosis. | This study aimed to develop and validate a multivariate diagnostic model based on the urinary epithelial cell adhesion molecule (EpCAM)-CD9-positive extracellular vesicles (EVs) (uEV We investigated the performance of uEV Results showed that uEV The multivariate model based on uEV Copyright © 2021 Dai, Wang, Cao, Yu, Zhang, Liu, Ping, Wang, Zhang, Sang, Wang and Tao. |
| 34926194 | Mesenchymal stem cell-derived exosomes inhibit the VEGF-A expression in human retinal vascular endothelial cells induced by high glucose. | Immunofluorescence analyses revealed that the upregulation of VEGF-A expression in HRECs stimulated by high glucose could be downregulated by cocultured hUCMSC-derived exosomes ( hUCMSC-derived exosomes downregulate VEGF-A expression in HRECs stimulated by high glucose in time and concentration dependent manner. To determine the effect of exosomes derived from human umbilical cord blood mesenchymal stem cells (hUCMSCs) on the expression of vascular endothelial growth factor A (VEGF-A) in human retinal vascular endothelial cells (HRECs). |
| 34926195 | Protective effects of umbilical cord mesenchymal stem cell exosomes in a diabetic rat model through live retinal imaging. | hucMSCs were subjected to differential ultracentrifugation for the collection of exosomes, and transmission electron microscopy (TEM), nanoparticle tracking analysis (NTA) using a NanoSight analysis system and Western blotting (WB) were used to analyze the expression of surface marker proteins such as CD63, CD9 and Calnexin. |
| 34965880 | Circulating extracellular vesicles activate the pyroptosis pathway in the brain following ventilation-induced lung injury. | Isolated EVs were enriched for the exosomal markers CD9 and CD81, suggesting enrichment for exosomes. |
| 34982509 | Engineered small extracellular vesicles displaying ACE2 variants on the surface protect against SARS-CoV-2 infection. | Although a clinical trial testing soluble ACE2 (sACE2) for COVID-19 is currently ongoing, our understanding of the delivery of sACE2 via small extracellular vesicles (sEVs) is still rudimentary. |
| 35006577 | Extracellular Vesicles from miR-148a-5p-Enriched Bone Marrow Mesenchymal Stem Cells Relieve Hepatic Fibrosis by Targeting Smad4. | Extracellular vesicles from miR-148a-5p enriched BMSCs downregulated the mRNA and protein levels of TGF-β1, TIMP-1, Collagen I, and α-SMA. Quantitative real-time PCR (qRT-PCR) and western blotting analysis were performed to detect the expressions of miR-148a-5p, Smad4, transforming growth factor-β1 (TGF-β1), tissue inhibitor of metalloproteinase 1 (TIMP-1), Collagen I, α-smooth muscle actin (α-SMA), and extracellular vesicle markers CD9, TSG101, CD63, and calnexin. |
| 35053007 | Proteomic Analysis of Exosomes Secreted from Human Alpha-1 Antitrypsin Overexpressing Mesenchymal Stromal Cells. | Both MSCs and hAAT-MSCs expressed exosome-associated proteins, including CD63, CD81, and CD9. However, there were differences between exosomes from control MSCs and hAAT-MSCs in cytokine signaling of the immune system, stem cell differentiation, and carbohydrate metabolism ( |